 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F103333 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 39 residues |
| Representative Sequence | EFAQKLADEIKPGTTVIVTDQPVVRNPIPDSTYFAAN |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 3.96 % |
| % of genes from short scaffolds (< 2000 bps) | 2.97 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.040 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.842 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.772 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.356 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00224 | PK | 9.90 |
| PF02887 | PK_C | 3.96 |
| PF00484 | Pro_CA | 3.96 |
| PF00343 | Phosphorylase | 2.97 |
| PF01116 | F_bP_aldolase | 2.97 |
| PF13193 | AMP-binding_C | 2.97 |
| PF03734 | YkuD | 1.98 |
| PF12697 | Abhydrolase_6 | 1.98 |
| PF14023 | DUF4239 | 1.98 |
| PF05990 | DUF900 | 1.98 |
| PF00027 | cNMP_binding | 1.98 |
| PF13387 | DUF4105 | 0.99 |
| PF11737 | DUF3300 | 0.99 |
| PF10011 | DUF2254 | 0.99 |
| PF00871 | Acetate_kinase | 0.99 |
| PF11964 | SpoIIAA-like | 0.99 |
| PF11742 | DUF3302 | 0.99 |
| PF01699 | Na_Ca_ex | 0.99 |
| PF13505 | OMP_b-brl | 0.99 |
| PF00920 | ILVD_EDD | 0.99 |
| PF03952 | Enolase_N | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 13.86 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 3.96 |
| COG0058 | Glucan phosphorylase | Carbohydrate transport and metabolism [G] | 2.97 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 2.97 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.98 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.98 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.98 |
| COG4782 | Esterase/lipase superfamily enzyme | General function prediction only [R] | 1.98 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.99 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.99 |
| COG0387 | Cation (Ca2+/Na+/K+)/H+ antiporter ChaA | Inorganic ion transport and metabolism [P] | 0.99 |
| COG0530 | Ca2+/Na+ antiporter | Inorganic ion transport and metabolism [P] | 0.99 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.04 % |
| All Organisms | root | All Organisms | 3.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005554|Ga0066661_10353405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 900 | Open in IMG/M |
| 3300012971|Ga0126369_12780691 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 573 | Open in IMG/M |
| 3300020582|Ga0210395_10009269 | All Organisms → cellular organisms → Bacteria | 7376 | Open in IMG/M |
| 3300025906|Ga0207699_11167408 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 570 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026816 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-B (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_04306210 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | IRFNTEFAQKLADEIKPGTTVIVTDQPVVRNPTADSTYFAAANQGGS |
| ICChiseqgaiiFebDRAFT_125411291 | 3300000363 | Soil | EFAQKLADEIKPGTTVIVTDQPVVRNPIPDSTYFAAN* |
| AF_2010_repII_A1DRAFT_101233551 | 3300000597 | Forest Soil | QKVADEIKPGTTVIVTDQPVVRKPKSDSTYFAAN* |
| JGI11643J11755_115593081 | 3300000787 | Soil | SPDFADKLAXELKPGTTVIVTDYPAVRNPVTESDVFAAK* |
| JGI1027J12803_1044491652 | 3300000955 | Soil | LRFSAEFAHKVAAEIAPGTTVIVTDAPAVRKPVVDSTYFAS* |
| JGI10216J12902_1185203741 | 3300000956 | Soil | AHKLADELKPGTTVVITDQPLVRNPIPDSTFFAVN* |
| C688J14111_100901913 | 3300001305 | Soil | QARLRFNPEFGEKLAQEMKPGTTVIVTDDPIVRRPKSDSSYFASN* |
| Ga0062593_1013117422 | 3300004114 | Soil | LLFNPEFAQKLADEIKPGTTVIVTDQQVVRKPAGDSEIFAAN* |
| Ga0063356_1009587373 | 3300004463 | Arabidopsis Thaliana Rhizosphere | FSPDFADKLANEMKPGTTVIVTDYQVVRKPKPDSTIFAVNEVR* |
| Ga0062594_1005140612 | 3300005093 | Soil | DFADKLANELKPGATVIVTDYQVVRKPKTDSTVFAVNEAR* |
| Ga0066683_108950822 | 3300005172 | Soil | NTEFAQKLADEIKTGTTVVVTDHPVVRKPKSDSTFFALN* |
| Ga0066671_109737322 | 3300005184 | Soil | FNTEFAQKLADEIKPGTTVIVTDDPVVRNPIPDSTYFAAN* |
| Ga0065704_107775782 | 3300005289 | Switchgrass Rhizosphere | IHFNTELAQKLADEIKPGTTVIVTDQPVVRKPTADSTYLAATN* |
| Ga0065715_106556142 | 3300005293 | Miscanthus Rhizosphere | TSEGKAVDADTLASRLHFSPDFADKLANELKPGATVIITDYPAVRNPVTQSDVFAAN* |
| Ga0066388_1067511342 | 3300005332 | Tropical Forest Soil | MNRIRNHFNTEFGQKPADEIKPGTTVIVTDQPVVRKSIPDPTYFAAD* |
| Ga0066661_103534051 | 3300005554 | Soil | AQKLADEIKPGTTVIVTDQPVVRKPTADPTYFAAK* |
| Ga0066705_104410442 | 3300005569 | Soil | FSPDFADKLANEMKPGTTVIVTDYPVVRNPKADSTYFAAK* |
| Ga0066702_101150422 | 3300005575 | Soil | TLESRLHFSPDFADKLANELKPGTTVVVTDYPVVRKQLVQSDVFATN* |
| Ga0066702_107579291 | 3300005575 | Soil | PEFANKVADVMKPGTTVVVTDQQVVRKPTSDSAYFAAN* |
| Ga0068857_1021974302 | 3300005577 | Corn Rhizosphere | SPDFADKLANELKPGTNVIATDYPVVRKPKPDAIFAVNDVP* |
| Ga0066706_112863341 | 3300005598 | Soil | PDFADKLANEMKPGTTVIVTDYPVVRKPITDSTVFAVN* |
| Ga0068856_1002123673 | 3300005614 | Corn Rhizosphere | LSPEFANKVADAMKPGTTVIVTDQQVVRKPTSDSTYFAAN* |
| Ga0066903_1012450222 | 3300005764 | Tropical Forest Soil | DFADKLAPELQPGSTVIVTDYPVVRKPTTQSDVFATN* |
| Ga0066903_1025143011 | 3300005764 | Tropical Forest Soil | FSPDFADKLANELKPGTTVIVTDYPAVRNPVTQSDVFAAK* |
| Ga0066903_1047368841 | 3300005764 | Tropical Forest Soil | PEFAQKLADQIQPGTTVIVTDQAVVRKPAGDAAIFASN* |
| Ga0070717_102278831 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EFALKLADTIKPGTTVVVTDEPVVRNPIPDSTYFAAN* |
| Ga0066652_1017809222 | 3300006046 | Soil | FSPDFADKLANEMKPGTTVIVTDYPVVRKPITDSTVFAVN* |
| Ga0068871_1018766871 | 3300006358 | Miscanthus Rhizosphere | TSEGRGVDADKLASRLHFSPDFADKLANELKPGAIVIVTDHTVVRKQVVQSDVFATN* |
| Ga0079222_108364032 | 3300006755 | Agricultural Soil | LQFSPDFADKLANELKPGTTVIVTDNVVARKPSGDAAIFAAN* |
| Ga0066665_100793891 | 3300006796 | Soil | RFNTEFAQKLADELKPGTTVIVTDEAVVRNPIPDSTYFAAN* |
| Ga0066665_101715172 | 3300006796 | Soil | HFSPEFGQKVADEIKPGTTVVVTDQPVVRKPKPDSTFFAFN* |
| Ga0075434_1010216732 | 3300006871 | Populus Rhizosphere | SPDFADKLANELKPGTTVIVTDYAVVRKPVADSTYFAAN* |
| Ga0066709_1026807091 | 3300009137 | Grasslands Soil | RFNTDFAQKLADEIKPGTTVIVTDQPAVRNPISDSTYFAAK* |
| Ga0066709_1040789921 | 3300009137 | Grasslands Soil | SPDFADKLANEMKPGTTVIVTDYPVVRKPITDSTVFAVN* |
| Ga0105243_113332762 | 3300009148 | Miscanthus Rhizosphere | FADKLANELKPGTNVIATDYPVVRKPKPDAIFAVNDVP* |
| Ga0075423_122383121 | 3300009162 | Populus Rhizosphere | NTDFAQKLADEIKPGTTVIVTDQQVVRRPVADSTYFAAN* |
| Ga0075423_124549441 | 3300009162 | Populus Rhizosphere | FSPDFADKLANELKPGTTVIVTDYPAIRNPITQSDVFASK* |
| Ga0126374_105251443 | 3300009792 | Tropical Forest Soil | DFADKLANELKPGTTVIVTDYPAVRNPVTQSDVFAAN* |
| Ga0126382_100576261 | 3300010047 | Tropical Forest Soil | LHFSPDFTDKLANEMKPSTTVIVTDYVMVRKPIADSGYFAAE* |
| Ga0126373_109168512 | 3300010048 | Tropical Forest Soil | FAQKLADEIKPGTTVIVTDQQVVRRPVADSTYFAAN* |
| Ga0126370_126652621 | 3300010358 | Tropical Forest Soil | DFADKLANELKPGTTVIVTDYPAVRNPVTQSDVFAAK* |
| Ga0126376_101996372 | 3300010359 | Tropical Forest Soil | FADKLANELKPGTTVIVTDYPAIRNPVTQSDVFAAK* |
| Ga0126376_103500761 | 3300010359 | Tropical Forest Soil | NTEFAQKLADEIKPGTTVVVTDQAVVRNALVDSTYFAAK* |
| Ga0126379_119947832 | 3300010366 | Tropical Forest Soil | ADKLANELKPGTTVIVTDYPAVRNPVTQSDVFAAK* |
| Ga0126379_124802623 | 3300010366 | Tropical Forest Soil | EFGQKVADELKPGTTVVVTDQVVVRKPSGDAAIFAAN* |
| Ga0137364_109178191 | 3300012198 | Vadose Zone Soil | FADKLANEMKPGTTVIVTDYPVVRKPITDSTVFAVN* |
| Ga0137362_115963591 | 3300012205 | Vadose Zone Soil | QKVADEIKPGTTVVVTDQPVVRKPKSDSTFFAVN* |
| Ga0137360_110801681 | 3300012361 | Vadose Zone Soil | SPEFAHKVADEIAPGTTVIVTDAPAVRKPVVDSTYFATK* |
| Ga0137358_102057273 | 3300012582 | Vadose Zone Soil | LHFSPDFADKLANELKPGTTVIVTDYPAIRNPVTQSDVFAAE* |
| Ga0137396_100765483 | 3300012918 | Vadose Zone Soil | NTDFAQKLADEIKPGTTVIVTDQPAVRNPISDSTYFAAK* |
| Ga0137359_114104123 | 3300012923 | Vadose Zone Soil | SPEFGQKVADEIKPGTTVVVTDQPVVRKPKSDSTFFAVN* |
| Ga0137416_110957021 | 3300012927 | Vadose Zone Soil | EFAHKVANEIAPGTTVIVTDAPAVRKPVVDSTYFASN* |
| Ga0164299_105852762 | 3300012958 | Soil | DFADKLANELNPGTTVIVTDYPVVRKPVTQSDVFAAN* |
| Ga0164301_108287451 | 3300012960 | Soil | SRLHFSSDFADKLANEMNPGTTVIVSDNAIVRKPVTQSDVFALN* |
| Ga0164301_111685952 | 3300012960 | Soil | HFSPDFADKLANELKPGTTVIVTDYQVVRKPKPDSTVFAVNEVR* |
| Ga0126369_127806912 | 3300012971 | Tropical Forest Soil | DKLANELKPGTTVIVTDYPAVRKPVTQSDVFAAN* |
| Ga0134110_100987011 | 3300012975 | Grasslands Soil | FADKLANELKPGTTVIVTDYPVVRKPKSDSTYFAVN* |
| Ga0157378_117691971 | 3300013297 | Miscanthus Rhizosphere | QFSSEFADKLANELKPGSTVIVTDYPVVRKPVAQSDVFAAN* |
| Ga0134079_106126801 | 3300014166 | Grasslands Soil | PEFAQKLADEIKPGTTVIVTDQPVVRKPTADPTYFAAN* |
| Ga0137418_100740164 | 3300015241 | Vadose Zone Soil | EFAITLADAITPGTTVIVTDQPAIRKPILDSTVFAN* |
| Ga0137412_105904013 | 3300015242 | Vadose Zone Soil | SPEFAHKVANEIAPGTTVIVTDAPAVRKPVVDSTYFASN* |
| Ga0132256_1002883732 | 3300015372 | Arabidopsis Rhizosphere | FSPDFADKLANELKPGTTVIVTDYAVVRKPVADSTYFAAN* |
| Ga0132257_1025729801 | 3300015373 | Arabidopsis Rhizosphere | PEFANKVADAMKPGTTVIVTDQPVVRKPTSDSTYFAAN* |
| Ga0182041_119803012 | 3300016294 | Soil | EFAQKVADEIAPGTTVIVTDATVVRKPVVDSTYFASS |
| Ga0182032_109788893 | 3300016357 | Soil | EFAHKVADEIAPGTTVIVTDAPAVRKPVVDSTYFATS |
| Ga0182034_104895823 | 3300016371 | Soil | GQKVADELKPGTTVVVTDQVVVRKPSGNAAIFAAN |
| Ga0182034_114658852 | 3300016371 | Soil | EFAQKVADEIAPGTTVIVTDTPAVRKPLVDSTYFANN |
| Ga0182040_107584151 | 3300016387 | Soil | PEFAQKVADEIAPGTTVIVTDAPVVRKPVVDSTYFANN |
| Ga0182038_106218011 | 3300016445 | Soil | PEFAHKVADEIAPGTTVIVTDAPAVRKPVVDSTYFATS |
| Ga0210395_100092691 | 3300020582 | Soil | STEFARKVADEIAPGTTVIVTDAPVVRKPVIDSTYFASN |
| Ga0210385_109759573 | 3300021402 | Soil | STEFAQKVADEIAPGTTVIVTDAPVVRKPVIDSTYFASN |
| Ga0210387_113367001 | 3300021405 | Soil | RFSTEFAHKVANEIAPGTTVIVTDARVVRKPVVDSTYFASN |
| Ga0210394_113044882 | 3300021420 | Soil | SPEFAHKVADEIAAGTTVIVTDAPAVRKPVVDPTYFAGN |
| Ga0210402_103879481 | 3300021478 | Soil | ANTVADAMKPGTTVIVTDQQVVRKPTSDSTYFAAN |
| Ga0126371_128960521 | 3300021560 | Tropical Forest Soil | FGDKVASELKPGATVIVTDYPAVRKPAAQSDVFAIN |
| Ga0126371_130368311 | 3300021560 | Tropical Forest Soil | IRFNTEFAQKLADELKPGTTVIVTDQPVVRNPVPDSTYFAAN |
| Ga0126371_136500961 | 3300021560 | Tropical Forest Soil | SRIRFNTDFAQKLADESKPGTTVVVTDEPVVRNPIPDSTYFAAN |
| Ga0207699_111674082 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | RPRFNPEFGQKVAYKIQPGTTVVITDQPVVQKPKSDSTFFAVN |
| Ga0207687_102262484 | 3300025927 | Miscanthus Rhizosphere | FADKLADQMKPGTTVIVTDHPAIRKPRADSTYFAAN |
| Ga0207683_100295051 | 3300026121 | Miscanthus Rhizosphere | ADKLANELKPGTTVIVTDTPVVRKPVTRSDVFALN |
| Ga0209055_12752752 | 3300026309 | Soil | SEFAQKLADELKPGTTVIVTDEPVVRNPIPDSTYFAAN |
| Ga0209472_11701611 | 3300026323 | Soil | ADKLANEMKPGTTVIVTDYPVVRNPKADSTYFAAK |
| Ga0179587_104588272 | 3300026557 | Vadose Zone Soil | SPDFADKLANELKPGTTVIVTDYPAIRNPVTQSDVFAAK |
| Ga0207509_1043131 | 3300026816 | Soil | LANELKPGTTVIVTDYQVVRKPKPDSTIFAVNEAR |
| Ga0209213_10528531 | 3300027383 | Forest Soil | SPEFAHKVADEITPGTTVIVTDTPAVRNPVVDSTYFATN |
| Ga0209622_10951372 | 3300027502 | Forest Soil | PEFAQKLADEIKPGTTVIVTDQPVVRKSIPDSTYFAVD |
| Ga0209180_100732531 | 3300027846 | Vadose Zone Soil | EFAQKLADELKPGTTVIVTDEPVVRNPIPDSTYFAAN |
| Ga0307301_100795482 | 3300028719 | Soil | FNSEFAQKLADEIKPGTTVIVTDQPVVRNPTADSTYFAAN |
| Ga0170824_1131677181 | 3300031231 | Forest Soil | IRFNREFAQKLADEIKPGTTVIVTDQPVVRNPTADSTYFAAK |
| Ga0307474_100381121 | 3300031718 | Hardwood Forest Soil | EFAHKVADGIAPGTTVIVTDAPVVRKPVIDSTYFANN |
| Ga0318509_107383761 | 3300031768 | Soil | FSPDFADKLANELKPGTTVIVTDYPAVRNPVTQSDVFAAN |
| Ga0306919_104429693 | 3300031879 | Soil | DFADELANELKPGTTVIVTDYPAVRNPVTQSDVFAAN |
| Ga0306921_103357273 | 3300031912 | Soil | GQKVTDELKPGTTVVVTDQVVVRKPSGDAAIFAAN |
| Ga0306921_106032841 | 3300031912 | Soil | FAQKVADEIAPGTTVIVTDAPAVRKPVVDSTYFANS |
| Ga0310912_114962981 | 3300031941 | Soil | HFSPEFGQKVADELKPGTTVVVTDQVVVRKPSGDAAIFAAN |
| Ga0310916_103364951 | 3300031942 | Soil | FAHKVADEIAPGTTVIVTDAPAVRKPVVDSTYFATS |
| Ga0310910_100864213 | 3300031946 | Soil | PEFAQKVADQIAPGTTVIVTGAPVVRKPVVDSTYFANN |
| Ga0310909_109155921 | 3300031947 | Soil | PDFADKLANELKPGTTVIVTDYPAIRNPVTQSDVFAAK |
| Ga0306922_102673511 | 3300032001 | Soil | LHFSPDFADKLANELKPGTTVIVTDYPAIRKPVTQSDVFAAN |
| Ga0306922_120292541 | 3300032001 | Soil | FADELANELKPGTTVIVTDYPAVRNPVTQSDVFAAN |
| Ga0318519_106878292 | 3300033290 | Soil | LRLSPEFAHKVVDEIAAGTTVIVTDAPAVRKPVVDSTYFATS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |