| Basic Information | |
|---|---|
| Family ID | F103241 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MITPPLVQLLIDAGFTDGWAISGDTLILWEHDQDPPAPLTRPEATDETPSPD |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 96.00 % |
| % of genes near scaffold ends (potentially truncated) | 9.90 % |
| % of genes from short scaffolds (< 2000 bps) | 76.24 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (72.277 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (36.634 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.257 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.465 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.00% β-sheet: 10.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 1.98 |
| PF07484 | Collar | 1.98 |
| PF02557 | VanY | 1.98 |
| PF04883 | HK97-gp10_like | 0.99 |
| PF05135 | Phage_connect_1 | 0.99 |
| PF02668 | TauD | 0.99 |
| PF14279 | HNH_5 | 0.99 |
| PF01464 | SLT | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.98 |
| COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.98 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.18 % |
| Unclassified | root | N/A | 17.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109884883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1973 | Open in IMG/M |
| 3300002835|B570J40625_101225452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
| 3300002835|B570J40625_101558823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
| 3300003430|JGI25921J50272_10048008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
| 3300004112|Ga0065166_10164203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
| 3300005581|Ga0049081_10018644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2631 | Open in IMG/M |
| 3300005582|Ga0049080_10005990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4212 | Open in IMG/M |
| 3300005584|Ga0049082_10315482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300005662|Ga0078894_10454657 | All Organisms → Viruses → Predicted Viral | 1153 | Open in IMG/M |
| 3300005662|Ga0078894_11489485 | Not Available | 562 | Open in IMG/M |
| 3300006484|Ga0070744_10073558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
| 3300006802|Ga0070749_10667808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300006805|Ga0075464_10006172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5717 | Open in IMG/M |
| 3300007559|Ga0102828_1006840 | Not Available | 2254 | Open in IMG/M |
| 3300007560|Ga0102913_1222456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300007590|Ga0102917_1164930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300007590|Ga0102917_1288512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
| 3300007603|Ga0102921_1366603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300007708|Ga0102859_1052548 | Not Available | 1131 | Open in IMG/M |
| 3300008450|Ga0114880_1056865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
| 3300009068|Ga0114973_10180887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
| 3300009155|Ga0114968_10032072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3509 | Open in IMG/M |
| 3300009158|Ga0114977_10171249 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
| 3300009159|Ga0114978_10181156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
| 3300009165|Ga0105102_10199926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
| 3300009169|Ga0105097_10863302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300009181|Ga0114969_10449481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300009181|Ga0114969_10584724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300009183|Ga0114974_10007382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8076 | Open in IMG/M |
| 3300010885|Ga0133913_12072752 | Not Available | 1409 | Open in IMG/M |
| 3300010885|Ga0133913_13249387 | All Organisms → Viruses → Predicted Viral | 1072 | Open in IMG/M |
| 3300012012|Ga0153799_1089153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300012013|Ga0153805_1005050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2340 | Open in IMG/M |
| 3300013004|Ga0164293_10343174 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300013004|Ga0164293_10666970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300013004|Ga0164293_10873374 | Not Available | 567 | Open in IMG/M |
| 3300013005|Ga0164292_10147140 | Not Available | 1725 | Open in IMG/M |
| 3300013005|Ga0164292_10812382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300013005|Ga0164292_11057905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
| 3300013372|Ga0177922_10712275 | Not Available | 1005 | Open in IMG/M |
| 3300013372|Ga0177922_11288639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1104 | Open in IMG/M |
| 3300017722|Ga0181347_1056222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1181 | Open in IMG/M |
| 3300017723|Ga0181362_1017563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1540 | Open in IMG/M |
| 3300017736|Ga0181365_1043270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1131 | Open in IMG/M |
| 3300017754|Ga0181344_1018651 | Not Available | 2165 | Open in IMG/M |
| 3300017754|Ga0181344_1027014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1762 | Open in IMG/M |
| 3300017766|Ga0181343_1101505 | Not Available | 817 | Open in IMG/M |
| 3300017778|Ga0181349_1028829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2240 | Open in IMG/M |
| 3300017785|Ga0181355_1015844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3299 | Open in IMG/M |
| 3300019784|Ga0181359_1073020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1296 | Open in IMG/M |
| 3300020205|Ga0211731_10212347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300020505|Ga0208088_1001866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3415 | Open in IMG/M |
| 3300020563|Ga0208082_1077008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300022179|Ga0181353_1120681 | Not Available | 627 | Open in IMG/M |
| 3300023184|Ga0214919_10322937 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300024343|Ga0244777_10116794 | All Organisms → Viruses → Predicted Viral | 1724 | Open in IMG/M |
| 3300024346|Ga0244775_10240328 | Not Available | 1511 | Open in IMG/M |
| 3300024348|Ga0244776_10250880 | Not Available | 1231 | Open in IMG/M |
| 3300025896|Ga0208916_10003383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6380 | Open in IMG/M |
| 3300027320|Ga0208923_1103791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300027586|Ga0208966_1137416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300027608|Ga0208974_1004259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5042 | Open in IMG/M |
| 3300027659|Ga0208975_1017788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2362 | Open in IMG/M |
| 3300027733|Ga0209297_1111017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1165 | Open in IMG/M |
| 3300027759|Ga0209296_1003749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10250 | Open in IMG/M |
| 3300027759|Ga0209296_1383855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
| 3300027785|Ga0209246_10086793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
| 3300027808|Ga0209354_10006365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4776 | Open in IMG/M |
| 3300027963|Ga0209400_1119003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1197 | Open in IMG/M |
| 3300033488|Ga0316621_10901252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300033984|Ga0334989_0268681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 918 | Open in IMG/M |
| 3300033992|Ga0334992_0220456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300033993|Ga0334994_0005929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8582 | Open in IMG/M |
| 3300033993|Ga0334994_0218081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
| 3300033993|Ga0334994_0275137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
| 3300033993|Ga0334994_0387930 | Not Available | 679 | Open in IMG/M |
| 3300033996|Ga0334979_0708986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300034012|Ga0334986_0169800 | Not Available | 1243 | Open in IMG/M |
| 3300034012|Ga0334986_0412737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300034060|Ga0334983_0148980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1482 | Open in IMG/M |
| 3300034061|Ga0334987_0281210 | Not Available | 1114 | Open in IMG/M |
| 3300034062|Ga0334995_0036126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4189 | Open in IMG/M |
| 3300034062|Ga0334995_0106185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2117 | Open in IMG/M |
| 3300034066|Ga0335019_0035917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3415 | Open in IMG/M |
| 3300034082|Ga0335020_0004643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8872 | Open in IMG/M |
| 3300034093|Ga0335012_0488632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300034095|Ga0335022_0169538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1334 | Open in IMG/M |
| 3300034095|Ga0335022_0394098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300034101|Ga0335027_0132763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1852 | Open in IMG/M |
| 3300034102|Ga0335029_0211898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1278 | Open in IMG/M |
| 3300034104|Ga0335031_0289023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1071 | Open in IMG/M |
| 3300034104|Ga0335031_0478297 | Not Available | 763 | Open in IMG/M |
| 3300034106|Ga0335036_0104056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2080 | Open in IMG/M |
| 3300034106|Ga0335036_0318051 | Not Available | 1028 | Open in IMG/M |
| 3300034118|Ga0335053_0163870 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
| 3300034272|Ga0335049_0524844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300034283|Ga0335007_0001888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16439 | Open in IMG/M |
| 3300034283|Ga0335007_0152009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → unclassified Chroococcales → Chroococcales cyanobacterium metabat2.561 | 1656 | Open in IMG/M |
| 3300034283|Ga0335007_0155254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1634 | Open in IMG/M |
| 3300034284|Ga0335013_0585839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 36.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.84% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.87% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.91% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.99% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.99% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1098848833 | 3300002408 | Freshwater | MIEKTKNEELCEMLAKKGFDTGWALLGETLTIWEHDQDPPAPLTRPQATDETPSPA* |
| B570J40625_1012254521 | 3300002835 | Freshwater | MTHEELVELLHNAGFADGWAMSGDTLVIWQHDQDPPAPLTRPEATDET |
| B570J40625_1015588232 | 3300002835 | Freshwater | MITPPLVQLLLDAGFIDGWAMAGETLTIWEHEEDPPAPLTRPQTDEPLE |
| JGI25921J50272_100480082 | 3300003430 | Freshwater Lake | MVQLLLDAGFNDGWVMSNDVLVVWEHDVDPPAPLERPTDE* |
| Ga0065166_101642032 | 3300004112 | Freshwater Lake | MKTPPMVQLLLDAGFNDGWVMSNDVLVVWEHDVDPPAPLERPTDE* |
| Ga0049081_100186442 | 3300005581 | Freshwater Lentic | MITPPMIQLLLDNGFTDGWAMSEETLVLWEHDEEPPAPLVRPAE* |
| Ga0049080_100059905 | 3300005582 | Freshwater Lentic | MITPPTVELLRKAGFDSGWALSDDTLILWEHDQEPPAPLTRPEATDETPSPD* |
| Ga0049082_103154822 | 3300005584 | Freshwater Lentic | MITPPMVQLLVDAGFNTGWAMAGDVLVLWEHDANPPAPLTRPEPTEPLE* |
| Ga0078894_104546572 | 3300005662 | Freshwater Lake | MNTSPMAQLLLDAGFTDGWALSGDVLVLWEHDEDPPAPLERPTDE* |
| Ga0078894_114894852 | 3300005662 | Freshwater Lake | MNHADAIELLLAAGFDSGWALAEGVLILWEHETDPPAPLERPNE* |
| Ga0070744_100735582 | 3300006484 | Estuarine | MTGSPIIQLLLDAGFSDGWAVAGDVLILWEHDQDPPAPLTRPEATDETPTAD* |
| Ga0070749_106678082 | 3300006802 | Aqueous | MIVSPMVELLTQAGFTDGWALAEDVLILWEHDEDPPAPLERPA* |
| Ga0075464_100061724 | 3300006805 | Aqueous | MITPAVVQLLLDAGFDSGWVCSGEELVLWEHDENPPAPLKRPE* |
| Ga0102828_10068402 | 3300007559 | Estuarine | MTHDELCQIVIDAGFDSGWAISGDTLILWEHDQDPPAPLTRPEATDETPSPA* |
| Ga0102913_12224562 | 3300007560 | Estuarine | GSMINPPLVQLLIDNGFTDGWAMSGETLVLWEHDVDPPAPLVKPSSTEEGQ* |
| Ga0102917_11649301 | 3300007590 | Estuarine | MINPPLVQLLIDNGFTDGWAMSGETLVLWEHDVDPPAPLVKPSSTEEGQ* |
| Ga0102917_12885122 | 3300007590 | Estuarine | MTHYEIVKLLNDAGFETGWALLGDTLTIWEHDEDPPAPLTRPEATDETPSPD* |
| Ga0102921_13666031 | 3300007603 | Estuarine | MTHKELCQMLYDNGFEDGWCLAGDTLTLWFHDQDPPAPLTRPEATDETPSPD* |
| Ga0102859_10525483 | 3300007708 | Estuarine | MNIEISPMHQLLLDAGYNSGWAMTGETLIIWEHDADPPAPLTRPEASDVVAS* |
| Ga0114880_10568653 | 3300008450 | Freshwater Lake | MNIEKTPMHQLLLDAGFDSGWAMAEEKLLIWEHDADPPAPLTRPEASDVVAG* |
| Ga0114973_101808873 | 3300009068 | Freshwater Lake | MITPPMVELLKTKGFDFGWAMCEETLILWEHDADPPAPLTRPEASDDLAS* |
| Ga0114968_100320724 | 3300009155 | Freshwater Lake | MITPPMVQLLLDAGFTDGWAMDGENLVLWEHDVDPPAPLTRPEAQDALAD* |
| Ga0114977_101712493 | 3300009158 | Freshwater Lake | MITPPMVQLLIDAGFTDGWAMSEDVLILWEHEEEPPAPLVRPAPLEDL* |
| Ga0114978_101811563 | 3300009159 | Freshwater Lake | MITPPMVKLLLDAGFTDGWALENETLVLWEHDVDPPAPLTRPKASNDLAG* |
| Ga0105102_101999263 | 3300009165 | Freshwater Sediment | PPMVQMLIEAGYTEGWAIHGDVLVLWEHEQDPPAPLTRPEATDETPSPN* |
| Ga0105097_108633022 | 3300009169 | Freshwater Sediment | MIGLELEMMLVEAGFNNGWAIADGKLILWEHDQDPPALLTRPKSTDETPSPD* |
| Ga0114969_104494812 | 3300009181 | Freshwater Lake | MIAPPMVKLLLDAGFNSGWAVAGDVLVLWEHDAEPPAPLIRPEPTEPLE* |
| Ga0114969_105847241 | 3300009181 | Freshwater Lake | MMTPPIVQLLLDAGFTDGWSLEEETLVLWEHDTDPPSPLIRPEATNETPTA |
| Ga0114974_100073826 | 3300009183 | Freshwater Lake | MTHKEATQVLIDAGFQSGWALTGDTLIFWEHDEDPPAPFVRPTE* |
| Ga0133913_120727523 | 3300010885 | Freshwater Lake | MTPPIVQLLLDAGFTDGWALEEETLVLWEHDTDPPSPLIRPEATNETPTAD* |
| Ga0133913_132493873 | 3300010885 | Freshwater Lake | MITPPMVELLLDAGFTDGWAMAGDVLVLWEHDQDPPAPLIRPEPTEPLE* |
| Ga0153799_10891532 | 3300012012 | Freshwater | MIISPMAQLLLDNGFNSGWAMCEETLVLWEHEENPPAPLTRPA* |
| Ga0153805_10050502 | 3300012013 | Surface Ice | MKTPPLAQLLLDAGFADGWGMAGETLVLWEHDVDPPAPLTRPEVSDDLAD* |
| Ga0164293_103431743 | 3300013004 | Freshwater | MTHDELVELLHEKGFISSWALSDQTLTHWDNDQDPPAPLTRPEATDETPSPD* |
| Ga0164293_106669702 | 3300013004 | Freshwater | MTHEELVELLHNAGFADGWAMSGDTLVIWQHDQDPPAPLTRPEATDETPSPA* |
| Ga0164293_108733742 | 3300013004 | Freshwater | MITPPMVQLLLDAGFTNGWVVAGDELILWEHEEDPPAPLVRPAE* |
| Ga0164292_101471404 | 3300013005 | Freshwater | MTHDELVELLHEKGFISGWALSDQTLTHWDNDQDPPAPLTRPEATDETPSPD* |
| Ga0164292_108123822 | 3300013005 | Freshwater | MNIPPMIEVLENAGFTDGWALHGDTLILWEHDQDPPAPLTRPEATDETPSPD* |
| Ga0164292_110579052 | 3300013005 | Freshwater | MTHEELVELLHNAGFADGWAMSGDTLVIWQHDQDPPAPLTR |
| Ga0177922_107122752 | 3300013372 | Freshwater | MNIELTPMHKLLLQHGYDSGYVISEEILQLWEHDADPPAPLTRPQAVNDLAG* |
| Ga0177922_112886392 | 3300013372 | Freshwater | VSHKELIELLLDAGFDSGWAISGDTLILWEHDQDPPAPLTRPEATDETPSPD* |
| Ga0119960_10245381 | 3300014811 | Aquatic | MNLSPIAQSLIDAGFTDGWAMADDVLTLWEHEQDPPAPLTRPEATDETPTAD* |
| Ga0181347_10562223 | 3300017722 | Freshwater Lake | MIPTPSPMHQLLLDNGFPDGWAMTEEKLILWEHDADPPAPITRPKVSDALED |
| Ga0181362_10175633 | 3300017723 | Freshwater Lake | MIPTPSPMHQLLLDNGFPDGWAMTEEKLILWEHDAAPPAPLTRPKVSDALED |
| Ga0181365_10432703 | 3300017736 | Freshwater Lake | MTTEEIMALLVDAGFTTGWSLVGTELALWEHDQDPPAPLTRPEVTDEAPTAD |
| Ga0181344_10186516 | 3300017754 | Freshwater Lake | MITDPTADLLIEAGFTDGWALSDGVLVLWEHDVDPPAPLVRPDEAPTADA |
| Ga0181344_10270143 | 3300017754 | Freshwater Lake | MNTSPMAQLLLDAGFTDGWALSGDVLVLWEHDEDPPAPLERPTDE |
| Ga0181343_11015052 | 3300017766 | Freshwater Lake | MITPPLVQLLIDAGFTDGWAISGDTLILWEHDQDPPAPLTRPEATDETPSPD |
| Ga0181349_10288293 | 3300017778 | Freshwater Lake | MTHDELCKLLTDNGFNDGWCLVGDILTLWFHDQDPPAPLTRPEATDETPTAD |
| Ga0181355_10158444 | 3300017785 | Freshwater Lake | MTHDELCKLLTDNGFNDGWCLVGDILTLWFHDQDPPAPLTRPSDNA |
| Ga0181359_10730202 | 3300019784 | Freshwater Lake | MIPTPSPMHQLLLDNGFPDGWAMTEEKLILWEHDADPPAPLTRPKVSDALED |
| Ga0211731_102123472 | 3300020205 | Freshwater | MITSPTIQLLLDAGFNSGWAVAGDVLVLWEHDADPPAPLTRPEPIEPLE |
| Ga0208088_10018664 | 3300020505 | Freshwater | MIEKTKNEELCEMLAKKGFDTGWALLGETLTIWEHDQDPPAPLTRPQATDETPSPA |
| Ga0208082_10770081 | 3300020563 | Freshwater | MSHEELCQMLYDNGFEDGWCLAGDTLTLWFHDQDPPAPLTRPKATDETPSPD |
| Ga0181353_11206812 | 3300022179 | Freshwater Lake | MSHEELTKLLEDNGFVDGWCLAGDTLILWEHDQDPPAPLVRPDETPSPD |
| Ga0214919_103229372 | 3300023184 | Freshwater | MITPPMIQLLLDNGFTDGWAMSDETLVLWEHEEEPPAPLVRPAE |
| Ga0244777_101167944 | 3300024343 | Estuarine | MINPPLVQLLIDNGFTDGWAMSGETLVLWEHDVDPPAPLVKPSSTEEGQ |
| Ga0244775_102403282 | 3300024346 | Estuarine | MTGSPIIQLLLDAGFSDGWAVAGDVLILWEHDQDPPAPLTRPEATDETPTAD |
| Ga0244776_102508803 | 3300024348 | Estuarine | MNIEISPMHQLLLDAGYNSGWAMTGETLIIWEHDADPPAPLTRPEASDVVAS |
| Ga0208916_100033835 | 3300025896 | Aqueous | MITPAVVQLLLDAGFDSGWVCSGEELVLWEHDENPPAPLKRPE |
| Ga0208923_11037912 | 3300027320 | Estuarine | MTHDELCQIVIDAGFDSGWAISGDTLILWEHDQDPPAPLTRPEATDETPSPA |
| Ga0208966_11374163 | 3300027586 | Freshwater Lentic | MITPPMVQLLVDAGFNTGWAMAGDVLVLWEHDANPPAPLTRPEPTEPLE |
| Ga0208974_10042595 | 3300027608 | Freshwater Lentic | MITPPTVELLRKAGFDSGWALSDDTLILWEHDQEPPAPLTRPEATDETPSPD |
| Ga0208975_10177882 | 3300027659 | Freshwater Lentic | MITPPMIQLLLDNGFTDGWAMSEETLVLWEHDEEPPAPLVRPAE |
| Ga0209297_11110173 | 3300027733 | Freshwater Lake | MITPPMVQLLIDAGFTDGWAMSEDVLILWEHEEEPPAPLVRPAPLEDL |
| Ga0209296_10037498 | 3300027759 | Freshwater Lake | MTHKEATQVLIDAGFQSGWALTGDTLIFWEHDEDPPAPFVRPTE |
| Ga0209296_13838552 | 3300027759 | Freshwater Lake | MITPPMVKLLLDAGFTDGWALENETLVLWEHDVDPPAPLTRPKASNDLAG |
| Ga0209246_100867931 | 3300027785 | Freshwater Lake | MIPTPSPMHQLLLDNGFPDGWAMTEEKLILWEHDADPPAPLTRPQASNDLAG |
| Ga0209354_100063657 | 3300027808 | Freshwater Lake | MPTPSPMHQLLLDNGFPDGWAMTEEKLILWEHDADPPAPLTRPKVSDALED |
| Ga0209400_11190033 | 3300027963 | Freshwater Lake | MITPPMVQLLLDAGFTDGWAMDGENLVLWEHDVDPPAPLTRPEAQDALAD |
| Ga0316621_109012522 | 3300033488 | Soil | MNTSPMAQLLLDAGFTDGWALQGDVLVLWEHDVDPPAPLERPADE |
| Ga0334989_0268681_3_119 | 3300033984 | Freshwater | MITPPLVQLLLDAGFTNGWAMFDDTLIIWEHEQDPPAPL |
| Ga0334992_0220456_292_450 | 3300033992 | Freshwater | MIYEPTPMHQLLLDNGYTDGWAMTEETLILWEHDEDPPAPLTRPKASDVVAD |
| Ga0334994_0005929_906_1064 | 3300033993 | Freshwater | MITPPMIQLLLDAGFTDGWAMSGETLTIWEHDQDPPAPLTRPEATNETPTAD |
| Ga0334994_0218081_881_1018 | 3300033993 | Freshwater | MITPPLVQLLLDAGFIDGWAMAGETLTIWEHEEDPPAPLTRPQTDE |
| Ga0334994_0275137_60_218 | 3300033993 | Freshwater | MTHEELVELLHNAGFADGWAMSGDTLVIWQHDQDPPAPLTRPEATDETPSPD |
| Ga0334994_0387930_151_309 | 3300033993 | Freshwater | MTHDELVELLHEKGFISGWALSDQTLTHWDNDQDPPAPLTRPEATDETPSPD |
| Ga0334979_0708986_118_276 | 3300033996 | Freshwater | MNIPPMIEVLENAGFTDGWALHGDTLILWEHDQDPPAPLTRPEATDETPSPD |
| Ga0334986_0169800_585_743 | 3300034012 | Freshwater | MTHEQLVELLHNAGFADGWAMSGDTLVIWQHDQDPPAPLTRPEATDETPSPD |
| Ga0334986_0412737_13_171 | 3300034012 | Freshwater | MTHEELVELLHNAGFADGWAMSGDTLVIWQHDQDPPAPLTRPEPKDETPSPD |
| Ga0334983_0148980_858_1016 | 3300034060 | Freshwater | MITPPMHQLLLDAGFTDGWAMADEVLILWEHDQDPPAPLTRPEATNETPTAD |
| Ga0334987_0281210_552_704 | 3300034061 | Freshwater | MTHLEAVQLLNENGYFSGYAITGETLILWLHDEDPPAPLTRPEASDVVAD |
| Ga0334995_0036126_4021_4182 | 3300034062 | Freshwater | MITPPLVQLLLDAGFIDGWAMAGETLTIWEHEEDPPAPLTRPQTDEPLEGEQP |
| Ga0334995_0106185_126_299 | 3300034062 | Freshwater | MITPPFVQLLIDSGFDDGWALSEETLVLWEHDEDPPAPLVRPQTEEPVDESAGGEQP |
| Ga0335019_0035917_374_532 | 3300034066 | Freshwater | MTHEQLVELLHNAGFADGWAMSGDTLVIWQHDQVPPAPLTRPEATDETPSPD |
| Ga0335020_0004643_2379_2513 | 3300034082 | Freshwater | MITPPMIQLLLDAGFTDGWAIADDVLTLWEHEEDPPAPLVRPAE |
| Ga0335012_0488632_2_127 | 3300034093 | Freshwater | MSENEMVALLLEKGFTSGWAVAEQKLVLWEHDEEPPAPLKRP |
| Ga0335022_0169538_1022_1180 | 3300034095 | Freshwater | MIITPSPMHQLLLDAGYNSGWAMTGETLTIWEHDEDPPAPLTRPEVGDDLAD |
| Ga0335022_0394098_133_285 | 3300034095 | Freshwater | MIIPPLVQLLLDAGYDSGWAMTGETLTIWEHEEDPPAPLTRPEVVDDLAG |
| Ga0335027_0132763_1382_1513 | 3300034101 | Freshwater | MKTPPMIELLLDAGFTDGWAVAGDVLVLWEHDEDPPPPLTRPE |
| Ga0335029_0211898_927_1085 | 3300034102 | Freshwater | MITPPMVQLLLDAGFIEGWAMAGETLTLWEHNADPPAPLTRPEPTDETPIAG |
| Ga0335031_0289023_594_731 | 3300034104 | Freshwater | MNTPPMVQLLLDAGFTDGWVMSNDVLVLWEHDVDPPAPLERPADE |
| Ga0335031_0478297_434_592 | 3300034104 | Freshwater | MNLSPIAQLLIDAGFTDGWAMSGDTLILWEHDQDPPAPLTRPEATDETLSHD |
| Ga0335036_0104056_1060_1212 | 3300034106 | Freshwater | MTHEDAIKVLVDAGFEAGWAMAGDILILWQHDADPPAPFTRPEVSDVVAD |
| Ga0335036_0318051_429_587 | 3300034106 | Freshwater | MITPPMHQLLLDAGFTDGWAMADEVLILWEHDQDPPTPPTRPEATDETPTAD |
| Ga0335053_0163870_632_790 | 3300034118 | Freshwater | MTHEQLVQLLHDAGFTSGWAMSGNSLIIWQHDQDPPAPLTRPEATDETPSPD |
| Ga0335049_0524844_587_745 | 3300034272 | Freshwater | MNIPPMIEVLENAGFTDGWALHGETLILWEHDQDPPAPLTRPEATDETHSPD |
| Ga0335007_0001888_3065_3199 | 3300034283 | Freshwater | MVQLLLDNGFTDGWAMSGETLVLWEHDVDPPAPLVKPSSTEEGQ |
| Ga0335007_0152009_13_171 | 3300034283 | Freshwater | MITPPLVQLLIDAGFTNGWAMFDDTLIIWEHEQDPPAPLTRPEATDETPSPD |
| Ga0335007_0155254_844_978 | 3300034283 | Freshwater | MITPPMVQLLIDAGFIDGWVISGDVLTLWEHDEDPPAPLVRPAE |
| Ga0335013_0585839_22_180 | 3300034284 | Freshwater | MTHEELVELLHNAGFADGWAMSGDTLVIWQHDQDPPAPLTRPEATDETPSPA |
| ⦗Top⦘ |