| Basic Information | |
|---|---|
| Family ID | F103214 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.01 % |
| % of genes from short scaffolds (< 2000 bps) | 92.08 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.317 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.683 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.772 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.465 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF03023 | MurJ | 22.77 |
| PF13631 | Cytochrom_B_N_2 | 8.91 |
| PF13635 | DUF4143 | 5.94 |
| PF07690 | MFS_1 | 4.95 |
| PF00583 | Acetyltransf_1 | 4.95 |
| PF13673 | Acetyltransf_10 | 1.98 |
| PF00144 | Beta-lactamase | 1.98 |
| PF08241 | Methyltransf_11 | 0.99 |
| PF03109 | ABC1 | 0.99 |
| PF00355 | Rieske | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 22.77 |
| COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 22.77 |
| COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 22.77 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.98 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.98 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.98 |
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.32 % |
| Unclassified | root | N/A | 31.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004080|Ga0062385_10456979 | Not Available | 778 | Open in IMG/M |
| 3300005355|Ga0070671_101869914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 534 | Open in IMG/M |
| 3300005434|Ga0070709_10945102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 683 | Open in IMG/M |
| 3300005439|Ga0070711_100400161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1114 | Open in IMG/M |
| 3300005454|Ga0066687_10605211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 651 | Open in IMG/M |
| 3300005591|Ga0070761_10516307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 738 | Open in IMG/M |
| 3300006573|Ga0074055_11873491 | Not Available | 652 | Open in IMG/M |
| 3300006804|Ga0079221_10140657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1248 | Open in IMG/M |
| 3300006806|Ga0079220_11648853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 558 | Open in IMG/M |
| 3300006806|Ga0079220_11789683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 541 | Open in IMG/M |
| 3300006954|Ga0079219_10026913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2218 | Open in IMG/M |
| 3300009520|Ga0116214_1078011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1211 | Open in IMG/M |
| 3300009520|Ga0116214_1086333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
| 3300009551|Ga0105238_10236629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1803 | Open in IMG/M |
| 3300009700|Ga0116217_10735049 | Not Available | 609 | Open in IMG/M |
| 3300009700|Ga0116217_11007064 | Not Available | 510 | Open in IMG/M |
| 3300010379|Ga0136449_101311421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1127 | Open in IMG/M |
| 3300010379|Ga0136449_101972121 | Not Available | 864 | Open in IMG/M |
| 3300010379|Ga0136449_101995744 | Not Available | 857 | Open in IMG/M |
| 3300010396|Ga0134126_11932925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 646 | Open in IMG/M |
| 3300010876|Ga0126361_10850359 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
| 3300011120|Ga0150983_14289911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1105 | Open in IMG/M |
| 3300012208|Ga0137376_10573627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 977 | Open in IMG/M |
| 3300012362|Ga0137361_10462634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1165 | Open in IMG/M |
| 3300012397|Ga0134056_1005020 | Not Available | 575 | Open in IMG/M |
| 3300012515|Ga0157338_1052971 | Not Available | 588 | Open in IMG/M |
| 3300012977|Ga0134087_10391027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 675 | Open in IMG/M |
| 3300012984|Ga0164309_10132429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1630 | Open in IMG/M |
| 3300012989|Ga0164305_11377213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 620 | Open in IMG/M |
| 3300012989|Ga0164305_12060170 | Not Available | 522 | Open in IMG/M |
| 3300013296|Ga0157374_11747226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 647 | Open in IMG/M |
| 3300013297|Ga0157378_12012958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 628 | Open in IMG/M |
| 3300014166|Ga0134079_10329558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 688 | Open in IMG/M |
| 3300016404|Ga0182037_11095629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 697 | Open in IMG/M |
| 3300016445|Ga0182038_10435470 | Not Available | 1106 | Open in IMG/M |
| 3300017932|Ga0187814_10244113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 680 | Open in IMG/M |
| 3300017937|Ga0187809_10035009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura roseirufa | 1607 | Open in IMG/M |
| 3300017959|Ga0187779_10822453 | Not Available | 635 | Open in IMG/M |
| 3300017973|Ga0187780_10826776 | Not Available | 671 | Open in IMG/M |
| 3300017999|Ga0187767_10360331 | Not Available | 514 | Open in IMG/M |
| 3300018060|Ga0187765_10617234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura roseirufa | 702 | Open in IMG/M |
| 3300018086|Ga0187769_11527393 | Not Available | 505 | Open in IMG/M |
| 3300019786|Ga0182025_1324981 | Not Available | 2239 | Open in IMG/M |
| 3300020582|Ga0210395_10203204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1486 | Open in IMG/M |
| 3300021171|Ga0210405_10287065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1301 | Open in IMG/M |
| 3300021405|Ga0210387_11581810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300021432|Ga0210384_11060844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
| 3300021474|Ga0210390_10132211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2096 | Open in IMG/M |
| 3300021474|Ga0210390_10160122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1898 | Open in IMG/M |
| 3300021474|Ga0210390_10491820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. HPF1205 | 1034 | Open in IMG/M |
| 3300021474|Ga0210390_10515792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1006 | Open in IMG/M |
| 3300021477|Ga0210398_10358937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1188 | Open in IMG/M |
| 3300021477|Ga0210398_10394942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1128 | Open in IMG/M |
| 3300021478|Ga0210402_10626252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 996 | Open in IMG/M |
| 3300025905|Ga0207685_10096334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1257 | Open in IMG/M |
| 3300025911|Ga0207654_10162770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1443 | Open in IMG/M |
| 3300025928|Ga0207700_10033718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3666 | Open in IMG/M |
| 3300025929|Ga0207664_11098008 | Not Available | 711 | Open in IMG/M |
| 3300027096|Ga0208099_1046424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 622 | Open in IMG/M |
| 3300027662|Ga0208565_1051368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1322 | Open in IMG/M |
| 3300027750|Ga0209461_10152606 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300027765|Ga0209073_10260617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 677 | Open in IMG/M |
| 3300027765|Ga0209073_10500285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 512 | Open in IMG/M |
| 3300027857|Ga0209166_10033696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3095 | Open in IMG/M |
| 3300028877|Ga0302235_10409971 | Not Available | 579 | Open in IMG/M |
| 3300029999|Ga0311339_10919826 | Not Available | 828 | Open in IMG/M |
| 3300030503|Ga0311370_10366116 | Not Available | 1829 | Open in IMG/M |
| 3300030617|Ga0311356_10525065 | Not Available | 1154 | Open in IMG/M |
| 3300030743|Ga0265461_11175916 | Not Available | 787 | Open in IMG/M |
| 3300031090|Ga0265760_10273147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300031236|Ga0302324_101154464 | Not Available | 1036 | Open in IMG/M |
| 3300031544|Ga0318534_10428771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 758 | Open in IMG/M |
| 3300031549|Ga0318571_10234777 | Not Available | 669 | Open in IMG/M |
| 3300031564|Ga0318573_10514879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 644 | Open in IMG/M |
| 3300031680|Ga0318574_10346368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 866 | Open in IMG/M |
| 3300031708|Ga0310686_105253210 | Not Available | 516 | Open in IMG/M |
| 3300031708|Ga0310686_107511644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 7765 | Open in IMG/M |
| 3300031715|Ga0307476_10789259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 702 | Open in IMG/M |
| 3300031720|Ga0307469_10462810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1101 | Open in IMG/M |
| 3300031747|Ga0318502_10539012 | Not Available | 700 | Open in IMG/M |
| 3300031765|Ga0318554_10492866 | Not Available | 693 | Open in IMG/M |
| 3300031770|Ga0318521_10135288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1389 | Open in IMG/M |
| 3300031771|Ga0318546_10343187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1038 | Open in IMG/M |
| 3300031777|Ga0318543_10315422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
| 3300031778|Ga0318498_10195044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 919 | Open in IMG/M |
| 3300031819|Ga0318568_10479466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300031846|Ga0318512_10684419 | Not Available | 525 | Open in IMG/M |
| 3300031859|Ga0318527_10417618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 572 | Open in IMG/M |
| 3300031860|Ga0318495_10033099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2260 | Open in IMG/M |
| 3300031897|Ga0318520_10107293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1575 | Open in IMG/M |
| 3300032001|Ga0306922_11015573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 855 | Open in IMG/M |
| 3300032009|Ga0318563_10666358 | Not Available | 559 | Open in IMG/M |
| 3300032010|Ga0318569_10237886 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300032042|Ga0318545_10265098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 617 | Open in IMG/M |
| 3300032044|Ga0318558_10530040 | Not Available | 588 | Open in IMG/M |
| 3300032054|Ga0318570_10317679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 708 | Open in IMG/M |
| 3300032160|Ga0311301_10179408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3707 | Open in IMG/M |
| 3300032782|Ga0335082_11605851 | Not Available | 523 | Open in IMG/M |
| 3300032828|Ga0335080_10842748 | Not Available | 944 | Open in IMG/M |
| 3300032954|Ga0335083_10209350 | Not Available | 1776 | Open in IMG/M |
| 3300033134|Ga0335073_10331225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1812 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.95% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.99% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.99% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062385_104569791 | 3300004080 | Bog Forest Soil | NGFANDSALQAGLTVATSVIMGVIVTGVALAVAVNLLSSFTLKGEPA* |
| Ga0070671_1018699141 | 3300005355 | Switchgrass Rhizosphere | ALQAGLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA* |
| Ga0070709_109451021 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NGLASDPVLEAGLGVLTSVVMGAIVTVVALAVAMNLLSSFTLKGEPA* |
| Ga0070711_1004001612 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TDPALQAGLGVLTSVVMGIIVTAAALLLAVSLLSSFTLKGEPA* |
| Ga0066687_106052111 | 3300005454 | Soil | LEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA* |
| Ga0070761_105163071 | 3300005591 | Soil | DTALNAGLNVTTSVVMGAIVTVIALVLAVRLLSSFTLKGEPT* |
| Ga0074055_118734911 | 3300006573 | Soil | EAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA* |
| Ga0079221_101406571 | 3300006804 | Agricultural Soil | AGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA* |
| Ga0079220_116488532 | 3300006806 | Agricultural Soil | DPALQAGLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA* |
| Ga0079220_117896832 | 3300006806 | Agricultural Soil | AGLGVLTSVVMGAIVTAVALALAMNLLSSFTLKGEPA* |
| Ga0079219_100269133 | 3300006954 | Agricultural Soil | DPALEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA* |
| Ga0116214_10780112 | 3300009520 | Peatlands Soil | NDPDLQAGLTVATSVVMGVIVTGLALVLAVNLLSSFTLKGEPA* |
| Ga0116214_10863331 | 3300009520 | Peatlands Soil | NAIAHDSSLMAGLNPATAIIMGSIVTVGALVLAINLLSGFTLKGEPA* |
| Ga0105238_102366291 | 3300009551 | Corn Rhizosphere | NDPLLEAGLGVLTSVVMGAIVTAVALALAMNLLSSFTLKGEPA* |
| Ga0116217_107350491 | 3300009700 | Peatlands Soil | LQAGLTVTTSVVMGVIVTGLALALAVNLLSSFTLKGEPA* |
| Ga0116217_110070642 | 3300009700 | Peatlands Soil | GFVNDTALQAGLTVTTSVVMGVIVTGLALALAVNLLSSFTLKGEPA* |
| Ga0136449_1013114212 | 3300010379 | Peatlands Soil | TVATSVVMGVIVTGVALAVAVNLLSSFTLKGEPA* |
| Ga0136449_1019721211 | 3300010379 | Peatlands Soil | PALQAGLTVTTAVVMGVIVTGLALALAVNLLSSFTLKGEPA* |
| Ga0136449_1019957442 | 3300010379 | Peatlands Soil | GLTVATSVIMGVIVTGVALAVAVNLLSSFTLKGEPA* |
| Ga0134126_119329252 | 3300010396 | Terrestrial Soil | PVLEAGLGVLTSVVMGAIVTVVALALAMNLLSSFSMKGEPA* |
| Ga0126361_108503593 | 3300010876 | Boreal Forest Soil | GLGVPTSVVMGAIVTVAALAVAVNLLSSFTLKGDPA* |
| Ga0150983_142899112 | 3300011120 | Forest Soil | SALAAGLTVTTSVVMGVIVTGIALALAVNLLSSFTLKGEPA* |
| Ga0137376_105736272 | 3300012208 | Vadose Zone Soil | GVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA* |
| Ga0137361_104626341 | 3300012362 | Vadose Zone Soil | PVLEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA* |
| Ga0134056_10050202 | 3300012397 | Grasslands Soil | ALEAGLGVLTSVVMGAIVTVAALALAMNLLSSFTLKGEPA* |
| Ga0157338_10529711 | 3300012515 | Arabidopsis Rhizosphere | NGLASDPALEAGLGVLTSIVMGAIVTVAALALAMNLLSSFTLKGEPA* |
| Ga0134087_103910272 | 3300012977 | Grasslands Soil | GLLTSVVMGAIVTAVALALGMNLLSSFTLKGEPA* |
| Ga0164309_101324291 | 3300012984 | Soil | NDPVLEAGLGVLTSVVMGAIVTAVALALAMNLLSSFTLKGEPA* |
| Ga0164305_113772131 | 3300012989 | Soil | SGFVADPALQAGLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA* |
| Ga0164305_120601701 | 3300012989 | Soil | AGLGVLTSVVMGAIVSVVALALAMNLLSSFTLKGEPA* |
| Ga0157374_117472261 | 3300013296 | Miscanthus Rhizosphere | LNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA* |
| Ga0157378_120129582 | 3300013297 | Miscanthus Rhizosphere | EAGLGVLTSVVMGAIVTVVALALAMNLLSSFSLKGEPA* |
| Ga0134079_103295582 | 3300014166 | Grasslands Soil | EAGLGLLTSVVMGAIVTAVALALGMNLLSSFTLKGEPA* |
| Ga0182037_110956292 | 3300016404 | Soil | LSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0182038_104354701 | 3300016445 | Soil | PVLEAGLGVLTSVVMGAIVTVAALVLAVNLLSSFTLKGEPA |
| Ga0187814_102441132 | 3300017932 | Freshwater Sediment | AGIAVPTAIIMGAIVTVGALALAINLLSGFTLKGEPA |
| Ga0187809_100350094 | 3300017937 | Freshwater Sediment | LTVTVSIVMGAIVTVVALLLAINLLSSFTLKGEPA |
| Ga0187779_108224531 | 3300017959 | Tropical Peatland | IAHDSSLNAGLTVTVSVVMGAIVTVAALLLAVNLLSSFTLKGEPA |
| Ga0187780_108267761 | 3300017973 | Tropical Peatland | AGLTPSTSVVMGGIVTAAALVLAVNLLSSFTLEGEPA |
| Ga0187767_103603312 | 3300017999 | Tropical Peatland | AHDATLNAGLTVTVSVVMGAIVTVAALALAINLLSAFTLKGEPA |
| Ga0187765_106172342 | 3300018060 | Tropical Peatland | GLTVTVSVVMGAIVTVAALLLAVNLLSSFTIKGEPA |
| Ga0187769_115273931 | 3300018086 | Tropical Peatland | ALQAGLGVATSVVMGVIVTAVALALAVNLLSSFTLKGEPA |
| Ga0182025_13249815 | 3300019786 | Permafrost | GFAHDPSLSAGLTVLTSVIMGAVVTVAALALAVNLLSSFTLKGEPA |
| Ga0210395_102032043 | 3300020582 | Soil | EAGLGVVTSVIMGAIVTAVALALAMNLLSSFTLKGEPA |
| Ga0210405_102870651 | 3300021171 | Soil | DSTLNAGLSVATSVVMGVIVTVAALVLAVNLLSSFTLKGEPA |
| Ga0210387_115818101 | 3300021405 | Soil | GTLNAGLSVATSVVMGVIVTVAALVLAVNLLSSFTLKGEPA |
| Ga0210384_110608441 | 3300021432 | Soil | HDSSLNAGLTVGVCIAMGAIVTVGALILAIRLLSSFTLKGEPA |
| Ga0210390_101322111 | 3300021474 | Soil | TLNAGLSVATSVVMGVIVTVAALVLAVNLLSSFTLKGEPA |
| Ga0210390_101601221 | 3300021474 | Soil | NGIAHDTTLNAGLSVATSVVMGVIVTVAALILAVRLLSSFTLKGEPA |
| Ga0210390_104918202 | 3300021474 | Soil | LLQAGLSALTSVIMGVIVTVGALVLAVNLLSGFTIKGEPA |
| Ga0210390_105157921 | 3300021474 | Soil | AGLTVVTSVVMGIIVTALALALAVNLLSSFTLKGEPA |
| Ga0210398_103589371 | 3300021477 | Soil | AHDSSLNAGLSVATSVVMGAIVTVAALVLAVNLLSSFTLKGEPA |
| Ga0210398_103949421 | 3300021477 | Soil | GIANGFINDSLLQAGLSLATSVVLGAIVTVGALVLAVRLLSGFTIKGEPA |
| Ga0210402_106262523 | 3300021478 | Soil | VLEAGLGLLTSVVMGAIVTTVALALATNLLSSFTLKGEPA |
| Ga0207685_100963342 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | EAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA |
| Ga0207654_101627703 | 3300025911 | Corn Rhizosphere | LGVLTSVVMGAIVTAVALALAMNLLSSFTLKGEPA |
| Ga0207700_100337181 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LEAGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA |
| Ga0207664_110980082 | 3300025929 | Agricultural Soil | AGLGVLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA |
| Ga0208099_10464241 | 3300027096 | Forest Soil | LNAGLSVATSVVMGVIVTVAALVLAVNLLSSFTLKGEPA |
| Ga0208565_10513682 | 3300027662 | Peatlands Soil | LQAGLTVTTSVVMGVIVTGLALALAVNLLSSFTLKGEPA |
| Ga0209461_101526061 | 3300027750 | Agave | SDPALEAGLGLLTSVVMGAIVTVVALALAMNLLSSFTLKGEPA |
| Ga0209073_102606172 | 3300027765 | Agricultural Soil | GLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA |
| Ga0209073_105002851 | 3300027765 | Agricultural Soil | GFVADPALQAGLNVLTSVVMGIIVTAAALLLAASLLSSFTIQGEPA |
| Ga0209166_100336964 | 3300027857 | Surface Soil | SLNAGLSTATSVVMGVIVTVAALVLAVRLLSGFTLKGEPA |
| Ga0302235_104099711 | 3300028877 | Palsa | LAAGLSVPTSVIMGAVVTVAALALAVNLLSSFTLKGEPA |
| Ga0311339_109198261 | 3300029999 | Palsa | GLSVPTSVIMGAVVTVAALALAVNLLSSFTLKGEPA |
| Ga0311370_103661161 | 3300030503 | Palsa | WIAHDSSLNAGLSVATSVVMGIIVTVAALVLAVNLLSSFTLKGEPA |
| Ga0311356_105250652 | 3300030617 | Palsa | AHDPALGAGLTTGTSVVMGAIVTVVALVLAVKLLTSFTLEGDPA |
| Ga0265461_111759162 | 3300030743 | Soil | AHDPSLDAGLAVPTSVIMGAVVTVAALALAVNLLSSYTLKGEPA |
| Ga0265760_102731471 | 3300031090 | Soil | GIAHDSSLNAGLSIATSVVMGAIVTVAALVLAVRLLSGFTLKGEPA |
| Ga0302324_1011544641 | 3300031236 | Palsa | HDPSLAAGLTVLTSVIMGALVTVAALALAVNLLSSFTLKGEPA |
| Ga0318534_104287711 | 3300031544 | Soil | SSLDAGLTVTVSIVMGAIVTVAALLLAVNLLSSFTLKGEPA |
| Ga0318571_102347772 | 3300031549 | Soil | GIAHDASLNAGLTVTVSVVMGAIVTVAALILAVNLLSGFTLKGEPA |
| Ga0318573_105148791 | 3300031564 | Soil | AHDTSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0318574_103463681 | 3300031680 | Soil | LTATVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0310686_1052532102 | 3300031708 | Soil | GLSVSTSVIMGAIFTVLALVLAVRLLSAFTLKGDPA |
| Ga0310686_1075116449 | 3300031708 | Soil | AGLSVPTSIIMGAIFTVLALVLAVRLLSGFTLKGDPA |
| Ga0307476_107892591 | 3300031715 | Hardwood Forest Soil | IAHDSTLNAGLSVATSVVMGVIVTVAALVLAVRLLSSFTLKGEPA |
| Ga0307469_104628101 | 3300031720 | Hardwood Forest Soil | EAGLGVLTSVVMGAIVTVVALALAMNLLSSFSLKGEPA |
| Ga0318502_105390121 | 3300031747 | Soil | ILNDPVLEAGLGVLTSVVMGAIVTVAALVLAVKLLSSFTLKGEPA |
| Ga0318554_104928661 | 3300031765 | Soil | ILNDPVLEAGLGVLTSVVMGAIVTVAALVLAVNLLSSFTLKGEPA |
| Ga0318521_101352881 | 3300031770 | Soil | DTSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0318546_103431872 | 3300031771 | Soil | GIVNDPVLEAGLGVLTSVLMGAIVTAAALALAMNLLSSFTLKGEPA |
| Ga0318543_103154221 | 3300031777 | Soil | HDSSLDAGLTVTVSIVMGAIVTVAALLLAVNLLSSFTLKGEPA |
| Ga0318498_101950441 | 3300031778 | Soil | NGIVNDPVLEAGLGVLTSVLMGAIVTAAALALAMNLLSSFTLKGEPA |
| Ga0318568_104794662 | 3300031819 | Soil | AHDSTLDAGLTATVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0318512_106844192 | 3300031846 | Soil | TSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0318527_104176181 | 3300031859 | Soil | NDPVLEAGLGVLTSVLMGAIVTAAALALAMNLLSSFTLKGEPA |
| Ga0318495_100330991 | 3300031860 | Soil | SSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0318520_101072931 | 3300031897 | Soil | GLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0306922_110155731 | 3300032001 | Soil | GIAHDSSLDAGLTVTVSIVMGAIVTVAALLLAVNLLSSFTLKGEPA |
| Ga0318563_106663581 | 3300032009 | Soil | LGVLTSVVMGAIVTVAALVLAVNLLSSFTLKGEPA |
| Ga0318569_102378861 | 3300032010 | Soil | ANAIAHDSTLDAGLTATVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0318545_102650981 | 3300032042 | Soil | DSSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0318558_105300401 | 3300032044 | Soil | SLDAGLTVTVSIVMGAIVTVAALLLAVNLLSSFTLKGEPA |
| Ga0318570_103176791 | 3300032054 | Soil | AYGIAHDSSLNAGLSVAVSIVMGAIVTVLALVLAINLLSSFTLKGEPA |
| Ga0311301_101794084 | 3300032160 | Peatlands Soil | DTALQAGLTMTTSVVMGVIVTGLALALAVNLLSSFTLKGEPA |
| Ga0335082_116058512 | 3300032782 | Soil | EAGLGVLTSVVMGAIVTAVALALAMNLLSSFALKGEPA |
| Ga0335080_108427482 | 3300032828 | Soil | GVLTSVVMGAIVTAVALVLAVNLLSSFTLKGEPAL |
| Ga0335083_102093501 | 3300032954 | Soil | LEAGLGVLTSVVMGTIVTVVALALAMNLLSSFTLKGEPA |
| Ga0335073_103312251 | 3300033134 | Soil | LQAGLNVLTSAGMGIIVTATALLLAASLLSSFTIQGEPA |
| ⦗Top⦘ |