NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103211

Metagenome / Metatranscriptome Family F103211

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103211
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 42 residues
Representative Sequence GNISVYVQNSEPGAAEQAPSEISWSPDSTFVVDSMEGAE
Number of Associated Samples 94
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.99 %
% of genes near scaffold ends (potentially truncated) 98.02 %
% of genes from short scaffolds (< 2000 bps) 96.04 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.040 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.752 % of family members)
Environment Ontology (ENVO) Unclassified
(24.752 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.475 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF13343SBP_bac_6 28.71
PF13416SBP_bac_8 21.78
PF01547SBP_bac_1 11.88
PF00202Aminotran_3 1.98
PF08402TOBE_2 0.99
PF00528BPD_transp_1 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000044|ARSoilOldRDRAFT_c006020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1021Open in IMG/M
3300000880|AL20A1W_1115884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria862Open in IMG/M
3300000891|JGI10214J12806_11220043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300001139|JGI10220J13317_10822385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300001305|C688J14111_10171702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300001536|A1565W1_12328663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces695Open in IMG/M
3300002568|C688J35102_120136088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300004479|Ga0062595_100401059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria983Open in IMG/M
3300005335|Ga0070666_11377093All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300005338|Ga0068868_100362884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1243Open in IMG/M
3300005543|Ga0070672_101809331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300005546|Ga0070696_100416234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1054Open in IMG/M
3300005564|Ga0070664_101632117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300005587|Ga0066654_10037722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2062Open in IMG/M
3300005874|Ga0075288_1030234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300006031|Ga0066651_10553522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300006574|Ga0074056_11404355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300006577|Ga0074050_11925902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1158Open in IMG/M
3300006804|Ga0079221_10806144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300006844|Ga0075428_100048614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4655Open in IMG/M
3300006904|Ga0075424_100718090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1067Open in IMG/M
3300006954|Ga0079219_10693850All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300007076|Ga0075435_100423304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1147Open in IMG/M
3300009137|Ga0066709_100670645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Angustibacter → unclassified Angustibacter → Angustibacter sp.1487Open in IMG/M
3300009147|Ga0114129_12418402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300010047|Ga0126382_11201668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300010145|Ga0126321_1296136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1297Open in IMG/M
3300010303|Ga0134082_10136412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300010320|Ga0134109_10125459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300010320|Ga0134109_10424764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300010322|Ga0134084_10165424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300010323|Ga0134086_10063602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1266Open in IMG/M
3300010329|Ga0134111_10133092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria975Open in IMG/M
3300010333|Ga0134080_10263276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300010360|Ga0126372_11374850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300010375|Ga0105239_11934712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300010396|Ga0134126_11000407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria936Open in IMG/M
3300010403|Ga0134123_10301070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1422Open in IMG/M
3300012206|Ga0137380_10580915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria981Open in IMG/M
3300012208|Ga0137376_10594026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300012209|Ga0137379_10596104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1012Open in IMG/M
3300012212|Ga0150985_106534268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300012356|Ga0137371_10351046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1146Open in IMG/M
3300012356|Ga0137371_10655584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria804Open in IMG/M
3300012360|Ga0137375_11457790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300012477|Ga0157336_1006400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria805Open in IMG/M
3300012514|Ga0157330_1043918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria611Open in IMG/M
3300012903|Ga0157289_10111862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300012905|Ga0157296_10216766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300012939|Ga0162650_100083450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300012961|Ga0164302_11823372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300012989|Ga0164305_10989451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300013102|Ga0157371_10349179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1077Open in IMG/M
3300014058|Ga0120149_1045627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1096Open in IMG/M
3300014326|Ga0157380_12035337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300015356|Ga0134073_10119449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300015374|Ga0132255_102461932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300017657|Ga0134074_1144413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria830Open in IMG/M
3300017947|Ga0187785_10610965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300017997|Ga0184610_1210530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300018032|Ga0187788_10070697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1219Open in IMG/M
3300018051|Ga0184620_10095096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria911Open in IMG/M
3300018052|Ga0184638_1109222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300018071|Ga0184618_10151897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300018072|Ga0184635_10294682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300019890|Ga0193728_1362494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300020070|Ga0206356_11316114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300021363|Ga0193699_10109972All Organisms → Viruses → Predicted Viral1118Open in IMG/M
3300021445|Ga0182009_10305882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300021951|Ga0222624_1440550All Organisms → Viruses → Predicted Viral1125Open in IMG/M
3300025960|Ga0207651_11199499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300025972|Ga0207668_11419121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria626Open in IMG/M
3300026078|Ga0207702_10515223All Organisms → Viruses → Predicted Viral1167Open in IMG/M
3300026330|Ga0209473_1194559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria773Open in IMG/M
3300026550|Ga0209474_10006187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10107Open in IMG/M
3300027787|Ga0209074_10017259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1899Open in IMG/M
3300027991|Ga0247683_1009654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria819Open in IMG/M
3300027993|Ga0247749_1052922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300028281|Ga0247689_1021712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300028712|Ga0307285_10042518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1117Open in IMG/M
3300028712|Ga0307285_10139583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300028716|Ga0307311_10033164All Organisms → Viruses → Predicted Viral1335Open in IMG/M
3300028716|Ga0307311_10272101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300028755|Ga0307316_10113104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria953Open in IMG/M
3300028787|Ga0307323_10007843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3533Open in IMG/M
3300028787|Ga0307323_10292134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300028810|Ga0307294_10070712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1055Open in IMG/M
3300028810|Ga0307294_10096758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300028872|Ga0307314_10122331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria730Open in IMG/M
3300028876|Ga0307286_10078939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1141Open in IMG/M
3300028881|Ga0307277_10355096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300031058|Ga0308189_10116876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria870Open in IMG/M
3300031091|Ga0308201_10345423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia544Open in IMG/M
3300031093|Ga0308197_10299884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300031114|Ga0308187_10017869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1609Open in IMG/M
3300031114|Ga0308187_10022772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1491Open in IMG/M
3300031421|Ga0308194_10036723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1187Open in IMG/M
3300034664|Ga0314786_005120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1681Open in IMG/M
3300034671|Ga0314796_029736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria948Open in IMG/M
3300034674|Ga0314799_021098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300034676|Ga0314801_003980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1948Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.75%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil8.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.94%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.97%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.98%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.99%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.99%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000044Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil oldHost-AssociatedOpen in IMG/M
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012477Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027991Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034671Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034674Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034676Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ARSoilOldRDRAFT_00602013300000044Arabidopsis RhizosphereGVATQYVLETRAGNVSVYVQNSEPGGRDQAPSEISWSPDSTFVVDSTEGDGTG*
AL20A1W_111588413300000880PermafrostVYVQNSEPGANQESPAEISWSPDSTFVVDHTEETE*
JGI10214J12806_1122004313300000891SoilCGNVSVYVQNSEPGVAEQAPSQISWSPDSTFVVDSMEGAE*
JGI10220J13317_1082238523300001139SoilTKAGNVCVYVQNSEPGARQEAPSEISWSPDSTFVVDSTEGDGTG*
C688J14111_1017170213300001305SoilDTKAGNVSVYVQNSEPGATQVVPSQISWSPESTFVVDSMEGAE*
A1565W1_1232866323300001536PermafrostMTXXXXVQNSEPGAQEQAPAEISWSPDSTFVVDHTEEME*
C688J35102_12013608813300002568SoilTRCGNVSVYVQNSEPGVAEQAPSQISWSPDSTFVVDSMEGAE*
Ga0062595_10040105913300004479SoilVATQYVLETRAGNVSVYVQNSEPGAGQAAPSDISWSPASTFVVDSTEGAE*
Ga0070666_1137709313300005335Switchgrass RhizosphereGVATQYVLETRAGNVSVYVQNSEPGAPDAAPSEISWSPDSTFVVDSMEGAEA*
Ga0068868_10036288413300005338Miscanthus RhizosphereRAGNVSVYVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEAE*
Ga0070672_10180933113300005543Miscanthus RhizosphereGNISVYVQNSEPGAAEQAPSEISWSPDSTFVVDSMEGAE*
Ga0070696_10041623423300005546Corn, Switchgrass And Miscanthus RhizosphereNVSVYVQNSEPGAREESPSQISWSPDSTFVVDSTEGAEE*
Ga0070664_10163211713300005564Corn RhizosphereYVQNSEPGAPDAAPSEISWSPDSTFVVDSMEGAEA*
Ga0066654_1003772213300005587SoilYVQNSEPGATQAPPSEISWSPSSTFVVDPMEGTE*
Ga0075288_103023423300005874Rice Paddy SoilGNVSVYVQNSEPGATQVAPSQISWSPGSTFVVDSMEGAE*
Ga0066651_1055352223300006031SoilGNISVYVQNSEPGATQVTPSEISWSPDSTFVVDSTEGTE*
Ga0074056_1140435523300006574SoilVSVYVQNSEPGAAEQSPSEISWSPDSTFVVDSMEGAE*
Ga0074050_1192590213300006577SoilKAGNVSLYVQNSEPGARQERAPSEISWSPDSTFVVDFTEGAE*
Ga0079221_1080614423300006804Agricultural SoilTRSGNVSVYVQNSEPGAAEQAPSKISWSPDSTFVVDSMEGAE*
Ga0075428_10004861413300006844Populus RhizosphereVYVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEAE*
Ga0075424_10071809023300006904Populus RhizosphereAGNVSVYVQNSEPGAADQAPTQISWSPDSTFVVDSTEEAE*
Ga0079219_1069385023300006954Agricultural SoilGVATQYVLETRAGNVSVYVQNSEPGAPEAAPSEISWSPDSTFVVDSMEGAEA*
Ga0075435_10042330413300007076Populus RhizosphereATQYVLETRAGNVSVYVQNSEPGAREESPSQISWSPDSTFVVDSTEGDGTG*
Ga0066709_10067064513300009137Grasslands SoilATQYVLDTRAGNISVYVQNSEPGAQQAVTGEISWSPDSTFVVDSMEGAEAE*
Ga0114129_1241840213300009147Populus RhizosphereVGVATQYVLETRAGNVSVYVQNSEPGARDQAPSEISWSPDSTFVVDSTEEVE*
Ga0126382_1120166813300010047Tropical Forest SoilVYVQNSQPGAPDAAPSEISWSPDSTFVVDSMEGAEA*
Ga0126321_129613613300010145SoilNVSMYVQNSEPGVRDQAPSDISWSPDSTFVVDSMEEAE*
Ga0134082_1013641223300010303Grasslands SoilVGVATQYVLETKAGNVSVYVQNSEPGARQDAPSEISWSPDSTFVVDSTEGAE*
Ga0134109_1012545923300010320Grasslands SoilYVQNSEPGAQQATPGEISWSPDSTFVVDSMEGAE*
Ga0134109_1042476423300010320Grasslands SoilYVQNSEPGASQAPPSNISWSPASTFVVDSMEGAQE*
Ga0134084_1016542423300010322Grasslands SoilTGNISVYVQNSEPGATQVTPSEISWSPDSTFVVDSTEGTE*
Ga0134086_1006360213300010323Grasslands SoilAGNVSVYVQNSEPGARDHTPSEISWSPDSTFVVDSTEEAE*
Ga0134111_1013309223300010329Grasslands SoilYVQNSEPGAQQATPGEISWSPDSTFVVDSTEGAE*
Ga0134080_1026327623300010333Grasslands SoilATQYVLDTRAGNVSVYVQNSEPGAQQAVTGEISWSPASTFVVDSTEGAEAE*
Ga0126372_1137485013300010360Tropical Forest SoilGVATQYVLETRAGNVSVYVQNSQPGTQEAVPSEISWSPDSTFVVDSMEGAEA*
Ga0105239_1193471223300010375Corn RhizosphereQYVLETRAGNVSVYVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEGE*
Ga0134126_1100040713300010396Terrestrial SoilNVSVYVQNSEPGATQVTPSEISWSPDSTFVVDSTEGAE*
Ga0134123_1030107013300010403Terrestrial SoilGNVSVYVQNSEPGAAEQAPSKISWSPDSTFVVDSMEGAE*
Ga0137380_1058091523300012206Vadose Zone SoilETKAGNVSIYVQNSEPGAQQATPDEFSWSPDSTFVVDSTEGAE*
Ga0137376_1059402623300012208Vadose Zone SoilGNVSVYVQNSEPGAQQKTPGEISWSPDSTFVVDHMEEAE*
Ga0137379_1059610413300012209Vadose Zone SoilETRAGNVSIYVQNSQPGANLETPSEISWSPDSTFVVDSMEGAEAE*
Ga0150985_10653426813300012212Avena Fatua RhizosphereLETRCGNVSVYVQNSEPGVAEQAPSQISWSPDSTFVVDSMEGAE*
Ga0137371_1035104613300012356Vadose Zone SoilAGNVSVYVQNSEPGAQQATPGEISWSPDSTFVVDSTEGAE*
Ga0137371_1065558423300012356Vadose Zone SoilGNVSIYVQNSEPGAQQATPGEFSWSPDSTFVVDSTEGAE*
Ga0137375_1145779013300012360Vadose Zone SoilTRAGDISVYVQNSEPGAADQAPGEISWSPDSTFVVDSMEGAEAE*
Ga0157336_100640013300012477Arabidopsis RhizosphereYVQNSEPGGRDQAPSEISWSPDSTFVVDSTEGDGTG*
Ga0157330_104391813300012514SoilVLETRAGNVSVYVQNSEPGGRDQAPSEISWSPDSTFVVDSTEGDGTG*
Ga0157289_1011186223300012903SoilLETRAGNVSVYVQNSEPGARDQAPAEISWSPDSTFVVDSTEEAE*
Ga0157296_1021676623300012905SoilETRAGNVSVYVQNSEPGARDQAPAEISWSPDSTFVVDSTEEAE*
Ga0162650_10008345013300012939SoilAGNVSLYVQNSEPGARDQAPSDISWSPDSTFVVDSTEGAE*
Ga0164302_1182337213300012961SoilNVSVYVQNSEPGAADQAPTQISWSPDSTFVVDSTEEAE*
Ga0164305_1098945123300012989SoilTQYVLETRAGNVSVYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGAEA*
Ga0157371_1034917913300013102Corn RhizosphereSVYVQNSEPGAAEQAPSKISWSPDSTFVVDSMEGAE*
Ga0120149_104562713300014058PermafrostYVQNSEPGAQEQAPAEISWSPDSTFVVDHTEEME*
Ga0157380_1203533713300014326Switchgrass RhizosphereYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE*
Ga0134073_1011944913300015356Grasslands SoilGVATQYVLETKAGNISVYVQNSEPGAMQAPPSEISWSPSSTFVVDPMEGTE*
Ga0132255_10246193213300015374Arabidopsis RhizosphereYVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEAE*
Ga0134074_114441313300017657Grasslands SoilNVSVYVQNSEPGAQQATPGEISWSPDSTFVVDSTEGAE
Ga0187785_1061096523300017947Tropical PeatlandTQYVLETKAGNVSLYVQNSEPGARQEAPSQISWSPDSTFVVDSMEGAE
Ga0184610_121053023300017997Groundwater SedimentVYVQNSEPGAREEAPSAISWSSDSTFVVDSTEGTE
Ga0187788_1007069713300018032Tropical PeatlandVSLYVQNSEPGASQTVPSDISWSPDSTFVVDSTEGAE
Ga0184620_1009509623300018051Groundwater SedimentVGVATQYVLETRAGNVSVYVQNSEPGAREEAPSAISWSSDSTFVVDSTEGTE
Ga0184638_110922213300018052Groundwater SedimentRAGNVSVYVQNSEPGAAEQAPSQISWSPDSTFVVDSMEGAE
Ga0184618_1015189723300018071Groundwater SedimentVLETRAGSVSVYVQNSEPGANQESPAEISWSPDSTFVVDHTEETE
Ga0184635_1029468223300018072Groundwater SedimentLETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEEAE
Ga0193728_136249423300019890SoilVATQYVLETRAGNVSVYVQNSEPGAGPAAPSQISWSPDSTFVVDSTEGAEE
Ga0206356_1131611413300020070Corn, Switchgrass And Miscanthus RhizosphereSVYVQNSEPGAAEQAPSEISWSPDSTFVVDSMEGAE
Ga0193699_1010997213300021363SoilVLETRCGNVSVYVQNSEPGAAEQAPSEISWSPDSTFVVDSTEGAE
Ga0182009_1030588213300021445SoilYVGVATQYVLETQAGNISVYVQNSEPGAREESPSQISWSTDSTFVVDSTEGAEE
Ga0222624_144055023300021951Groundwater SedimentETRAGNVSVYVQNSEPGAREEAPSAISWSSDSTFVVDSTEGTE
Ga0207651_1119949913300025960Switchgrass RhizosphereGNISVYVQNSEPGAAEQAPSEISWSPDSTFVVDSMEGAE
Ga0207668_1141912113300025972Switchgrass RhizosphereYVLETRAGNVSVYVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEAE
Ga0207702_1051522313300026078Corn RhizosphereTRAGNVSVYVQNSEPGAPDAAPSEISWSPDSTFVVDSMEGAEA
Ga0209473_119455913300026330SoilYVLETKAGNISVYVQNSEPGATQAPPSEISWSPSSTFVVDPMEGTE
Ga0209474_1000618713300026550SoilETKTGNISVYVQNSEPGATQVTPSEISWSPDSTFVVDSTEGTE
Ga0209074_1001725913300027787Agricultural SoilYVLETRSGNVSVYVQNSEPGAAEQAPSKISWSPDSTFVVDSMEGAE
Ga0247683_100965423300027991SoilTRAGNVSVYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGAEA
Ga0247749_105292223300027993SoilSVYVQNSEPGARDQAPAEISWSPDSTFVVDSTEEAE
Ga0247689_102171213300028281SoilNVSVYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGAEA
Ga0307285_1004251823300028712SoilYVLETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE
Ga0307285_1013958323300028712SoilTQYVLETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE
Ga0307311_1003316423300028716SoilVLETRAGNVSVYVQNSEPGAREEAPSAISWSSDSTFVVDSTEGTE
Ga0307311_1027210113300028716SoilVATQYVLETRAGNVSVYVQNSEPGAEQAAPSDISWRPASTFVVDFTEGAE
Ga0307316_1011310413300028755SoilISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE
Ga0307323_1000784353300028787SoilGNISVYVQNSEPARSQIAPGEISWSSDSTFVVDSTEGAE
Ga0307323_1029213423300028787SoilTRAGNISVYVQNSEPGTQQAAPSEISWSPDSTFVVDSTEGAEAE
Ga0307294_1007071223300028810SoilNISIYVQNSEPGASDQAPSEISWSPDSTFVVDHTEGVE
Ga0307294_1009675813300028810SoilNISVYVQNSEPGARDHAPSEISWSPDSTFVVDSTEEAE
Ga0307314_1012233113300028872SoilVLETGAGSISIYVQNSEPGASDQAPSEISWSPDSTFVVDHTEGVE
Ga0307286_1007893913300028876SoilVLETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE
Ga0307277_1035509623300028881SoilGVATQYVLETKSGNVSVYVQNSEPGAAEQAPSQISWSPDSTFVVDSMEGAE
Ga0308189_1011687613300031058SoilVATQYVLETKAGNVSVYVQNSEPGAALAAPSQISWSPDSTFVVDSMEGAEE
Ga0308201_1034542313300031091SoilTKAGNVSVYVQNSEPGAALAAPSQISWSPDSTFVVDSMEGAEE
Ga0308197_1029988413300031093SoilGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE
Ga0308187_1001786913300031114SoilTQYVLETKSGNVSVYVQNSEPGAAEQAPSQISWSPDSTFVVDSMEGAE
Ga0308187_1002277233300031114SoilETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE
Ga0308194_1003672323300031421SoilVSVYVQNSEPGAALAAPSQISWSPDSTFVVDSMEGAEE
Ga0314786_005120_2_1123300034664SoilVYVQNSEPGVAEQAPSEISWSPDSTFVVDSTEGAEA
Ga0314796_029736_13_1233300034671SoilVYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGAEA
Ga0314799_021098_584_6913300034674SoilYVQNSEPGAPDAAPSEISWSPDSTFVVDSMEGAEA
Ga0314801_003980_1_1533300034676SoilATQYVLETRAGNVSVYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGVEA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.