| Basic Information | |
|---|---|
| Family ID | F103211 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GNISVYVQNSEPGAAEQAPSEISWSPDSTFVVDSMEGAE |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.99 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 96.04 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.040 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.752 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.475 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF13343 | SBP_bac_6 | 28.71 |
| PF13416 | SBP_bac_8 | 21.78 |
| PF01547 | SBP_bac_1 | 11.88 |
| PF00202 | Aminotran_3 | 1.98 |
| PF08402 | TOBE_2 | 0.99 |
| PF00528 | BPD_transp_1 | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000044|ARSoilOldRDRAFT_c006020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1021 | Open in IMG/M |
| 3300000880|AL20A1W_1115884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
| 3300000891|JGI10214J12806_11220043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300001139|JGI10220J13317_10822385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300001305|C688J14111_10171702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300001536|A1565W1_12328663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 695 | Open in IMG/M |
| 3300002568|C688J35102_120136088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
| 3300004479|Ga0062595_100401059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
| 3300005335|Ga0070666_11377093 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005338|Ga0068868_100362884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1243 | Open in IMG/M |
| 3300005543|Ga0070672_101809331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300005546|Ga0070696_100416234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1054 | Open in IMG/M |
| 3300005564|Ga0070664_101632117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300005587|Ga0066654_10037722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2062 | Open in IMG/M |
| 3300005874|Ga0075288_1030234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300006031|Ga0066651_10553522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300006574|Ga0074056_11404355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300006577|Ga0074050_11925902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1158 | Open in IMG/M |
| 3300006804|Ga0079221_10806144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300006844|Ga0075428_100048614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4655 | Open in IMG/M |
| 3300006904|Ga0075424_100718090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
| 3300006954|Ga0079219_10693850 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300007076|Ga0075435_100423304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1147 | Open in IMG/M |
| 3300009137|Ga0066709_100670645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Angustibacter → unclassified Angustibacter → Angustibacter sp. | 1487 | Open in IMG/M |
| 3300009147|Ga0114129_12418402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300010047|Ga0126382_11201668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300010145|Ga0126321_1296136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1297 | Open in IMG/M |
| 3300010303|Ga0134082_10136412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
| 3300010320|Ga0134109_10125459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300010320|Ga0134109_10424764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300010322|Ga0134084_10165424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300010323|Ga0134086_10063602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300010329|Ga0134111_10133092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300010333|Ga0134080_10263276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300010360|Ga0126372_11374850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
| 3300010375|Ga0105239_11934712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300010396|Ga0134126_11000407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
| 3300010403|Ga0134123_10301070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1422 | Open in IMG/M |
| 3300012206|Ga0137380_10580915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
| 3300012208|Ga0137376_10594026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300012209|Ga0137379_10596104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
| 3300012212|Ga0150985_106534268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300012356|Ga0137371_10351046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1146 | Open in IMG/M |
| 3300012356|Ga0137371_10655584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300012360|Ga0137375_11457790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300012477|Ga0157336_1006400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300012514|Ga0157330_1043918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300012903|Ga0157289_10111862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300012905|Ga0157296_10216766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300012939|Ga0162650_100083450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300012961|Ga0164302_11823372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300012989|Ga0164305_10989451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300013102|Ga0157371_10349179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
| 3300014058|Ga0120149_1045627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1096 | Open in IMG/M |
| 3300014326|Ga0157380_12035337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300015356|Ga0134073_10119449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300015374|Ga0132255_102461932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300017657|Ga0134074_1144413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
| 3300017947|Ga0187785_10610965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300017997|Ga0184610_1210530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300018032|Ga0187788_10070697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1219 | Open in IMG/M |
| 3300018051|Ga0184620_10095096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 911 | Open in IMG/M |
| 3300018052|Ga0184638_1109222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
| 3300018071|Ga0184618_10151897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300018072|Ga0184635_10294682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300019890|Ga0193728_1362494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300020070|Ga0206356_11316114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300021363|Ga0193699_10109972 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300021445|Ga0182009_10305882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
| 3300021951|Ga0222624_1440550 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
| 3300025960|Ga0207651_11199499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300025972|Ga0207668_11419121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
| 3300026078|Ga0207702_10515223 | All Organisms → Viruses → Predicted Viral | 1167 | Open in IMG/M |
| 3300026330|Ga0209473_1194559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300026550|Ga0209474_10006187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10107 | Open in IMG/M |
| 3300027787|Ga0209074_10017259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1899 | Open in IMG/M |
| 3300027991|Ga0247683_1009654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300027993|Ga0247749_1052922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300028281|Ga0247689_1021712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
| 3300028712|Ga0307285_10042518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1117 | Open in IMG/M |
| 3300028712|Ga0307285_10139583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300028716|Ga0307311_10033164 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300028716|Ga0307311_10272101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300028755|Ga0307316_10113104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
| 3300028787|Ga0307323_10007843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3533 | Open in IMG/M |
| 3300028787|Ga0307323_10292134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300028810|Ga0307294_10070712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300028810|Ga0307294_10096758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300028872|Ga0307314_10122331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300028876|Ga0307286_10078939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
| 3300028881|Ga0307277_10355096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 653 | Open in IMG/M |
| 3300031058|Ga0308189_10116876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300031091|Ga0308201_10345423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 544 | Open in IMG/M |
| 3300031093|Ga0308197_10299884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300031114|Ga0308187_10017869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1609 | Open in IMG/M |
| 3300031114|Ga0308187_10022772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1491 | Open in IMG/M |
| 3300031421|Ga0308194_10036723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1187 | Open in IMG/M |
| 3300034664|Ga0314786_005120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1681 | Open in IMG/M |
| 3300034671|Ga0314796_029736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
| 3300034674|Ga0314799_021098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300034676|Ga0314801_003980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1948 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.75% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.97% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.99% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.99% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027991 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24 | Environmental | Open in IMG/M |
| 3300027993 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5 | Environmental | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034671 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034674 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARSoilOldRDRAFT_0060201 | 3300000044 | Arabidopsis Rhizosphere | GVATQYVLETRAGNVSVYVQNSEPGGRDQAPSEISWSPDSTFVVDSTEGDGTG* |
| AL20A1W_11158841 | 3300000880 | Permafrost | VYVQNSEPGANQESPAEISWSPDSTFVVDHTEETE* |
| JGI10214J12806_112200431 | 3300000891 | Soil | CGNVSVYVQNSEPGVAEQAPSQISWSPDSTFVVDSMEGAE* |
| JGI10220J13317_108223852 | 3300001139 | Soil | TKAGNVCVYVQNSEPGARQEAPSEISWSPDSTFVVDSTEGDGTG* |
| C688J14111_101717021 | 3300001305 | Soil | DTKAGNVSVYVQNSEPGATQVVPSQISWSPESTFVVDSMEGAE* |
| A1565W1_123286632 | 3300001536 | Permafrost | MTXXXXVQNSEPGAQEQAPAEISWSPDSTFVVDHTEEME* |
| C688J35102_1201360881 | 3300002568 | Soil | TRCGNVSVYVQNSEPGVAEQAPSQISWSPDSTFVVDSMEGAE* |
| Ga0062595_1004010591 | 3300004479 | Soil | VATQYVLETRAGNVSVYVQNSEPGAGQAAPSDISWSPASTFVVDSTEGAE* |
| Ga0070666_113770931 | 3300005335 | Switchgrass Rhizosphere | GVATQYVLETRAGNVSVYVQNSEPGAPDAAPSEISWSPDSTFVVDSMEGAEA* |
| Ga0068868_1003628841 | 3300005338 | Miscanthus Rhizosphere | RAGNVSVYVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEAE* |
| Ga0070672_1018093311 | 3300005543 | Miscanthus Rhizosphere | GNISVYVQNSEPGAAEQAPSEISWSPDSTFVVDSMEGAE* |
| Ga0070696_1004162342 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | NVSVYVQNSEPGAREESPSQISWSPDSTFVVDSTEGAEE* |
| Ga0070664_1016321171 | 3300005564 | Corn Rhizosphere | YVQNSEPGAPDAAPSEISWSPDSTFVVDSMEGAEA* |
| Ga0066654_100377221 | 3300005587 | Soil | YVQNSEPGATQAPPSEISWSPSSTFVVDPMEGTE* |
| Ga0075288_10302342 | 3300005874 | Rice Paddy Soil | GNVSVYVQNSEPGATQVAPSQISWSPGSTFVVDSMEGAE* |
| Ga0066651_105535222 | 3300006031 | Soil | GNISVYVQNSEPGATQVTPSEISWSPDSTFVVDSTEGTE* |
| Ga0074056_114043552 | 3300006574 | Soil | VSVYVQNSEPGAAEQSPSEISWSPDSTFVVDSMEGAE* |
| Ga0074050_119259021 | 3300006577 | Soil | KAGNVSLYVQNSEPGARQERAPSEISWSPDSTFVVDFTEGAE* |
| Ga0079221_108061442 | 3300006804 | Agricultural Soil | TRSGNVSVYVQNSEPGAAEQAPSKISWSPDSTFVVDSMEGAE* |
| Ga0075428_1000486141 | 3300006844 | Populus Rhizosphere | VYVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEAE* |
| Ga0075424_1007180902 | 3300006904 | Populus Rhizosphere | AGNVSVYVQNSEPGAADQAPTQISWSPDSTFVVDSTEEAE* |
| Ga0079219_106938502 | 3300006954 | Agricultural Soil | GVATQYVLETRAGNVSVYVQNSEPGAPEAAPSEISWSPDSTFVVDSMEGAEA* |
| Ga0075435_1004233041 | 3300007076 | Populus Rhizosphere | ATQYVLETRAGNVSVYVQNSEPGAREESPSQISWSPDSTFVVDSTEGDGTG* |
| Ga0066709_1006706451 | 3300009137 | Grasslands Soil | ATQYVLDTRAGNISVYVQNSEPGAQQAVTGEISWSPDSTFVVDSMEGAEAE* |
| Ga0114129_124184021 | 3300009147 | Populus Rhizosphere | VGVATQYVLETRAGNVSVYVQNSEPGARDQAPSEISWSPDSTFVVDSTEEVE* |
| Ga0126382_112016681 | 3300010047 | Tropical Forest Soil | VYVQNSQPGAPDAAPSEISWSPDSTFVVDSMEGAEA* |
| Ga0126321_12961361 | 3300010145 | Soil | NVSMYVQNSEPGVRDQAPSDISWSPDSTFVVDSMEEAE* |
| Ga0134082_101364122 | 3300010303 | Grasslands Soil | VGVATQYVLETKAGNVSVYVQNSEPGARQDAPSEISWSPDSTFVVDSTEGAE* |
| Ga0134109_101254592 | 3300010320 | Grasslands Soil | YVQNSEPGAQQATPGEISWSPDSTFVVDSMEGAE* |
| Ga0134109_104247642 | 3300010320 | Grasslands Soil | YVQNSEPGASQAPPSNISWSPASTFVVDSMEGAQE* |
| Ga0134084_101654242 | 3300010322 | Grasslands Soil | TGNISVYVQNSEPGATQVTPSEISWSPDSTFVVDSTEGTE* |
| Ga0134086_100636021 | 3300010323 | Grasslands Soil | AGNVSVYVQNSEPGARDHTPSEISWSPDSTFVVDSTEEAE* |
| Ga0134111_101330922 | 3300010329 | Grasslands Soil | YVQNSEPGAQQATPGEISWSPDSTFVVDSTEGAE* |
| Ga0134080_102632762 | 3300010333 | Grasslands Soil | ATQYVLDTRAGNVSVYVQNSEPGAQQAVTGEISWSPASTFVVDSTEGAEAE* |
| Ga0126372_113748501 | 3300010360 | Tropical Forest Soil | GVATQYVLETRAGNVSVYVQNSQPGTQEAVPSEISWSPDSTFVVDSMEGAEA* |
| Ga0105239_119347122 | 3300010375 | Corn Rhizosphere | QYVLETRAGNVSVYVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEGE* |
| Ga0134126_110004071 | 3300010396 | Terrestrial Soil | NVSVYVQNSEPGATQVTPSEISWSPDSTFVVDSTEGAE* |
| Ga0134123_103010701 | 3300010403 | Terrestrial Soil | GNVSVYVQNSEPGAAEQAPSKISWSPDSTFVVDSMEGAE* |
| Ga0137380_105809152 | 3300012206 | Vadose Zone Soil | ETKAGNVSIYVQNSEPGAQQATPDEFSWSPDSTFVVDSTEGAE* |
| Ga0137376_105940262 | 3300012208 | Vadose Zone Soil | GNVSVYVQNSEPGAQQKTPGEISWSPDSTFVVDHMEEAE* |
| Ga0137379_105961041 | 3300012209 | Vadose Zone Soil | ETRAGNVSIYVQNSQPGANLETPSEISWSPDSTFVVDSMEGAEAE* |
| Ga0150985_1065342681 | 3300012212 | Avena Fatua Rhizosphere | LETRCGNVSVYVQNSEPGVAEQAPSQISWSPDSTFVVDSMEGAE* |
| Ga0137371_103510461 | 3300012356 | Vadose Zone Soil | AGNVSVYVQNSEPGAQQATPGEISWSPDSTFVVDSTEGAE* |
| Ga0137371_106555842 | 3300012356 | Vadose Zone Soil | GNVSIYVQNSEPGAQQATPGEFSWSPDSTFVVDSTEGAE* |
| Ga0137375_114577901 | 3300012360 | Vadose Zone Soil | TRAGDISVYVQNSEPGAADQAPGEISWSPDSTFVVDSMEGAEAE* |
| Ga0157336_10064001 | 3300012477 | Arabidopsis Rhizosphere | YVQNSEPGGRDQAPSEISWSPDSTFVVDSTEGDGTG* |
| Ga0157330_10439181 | 3300012514 | Soil | VLETRAGNVSVYVQNSEPGGRDQAPSEISWSPDSTFVVDSTEGDGTG* |
| Ga0157289_101118622 | 3300012903 | Soil | LETRAGNVSVYVQNSEPGARDQAPAEISWSPDSTFVVDSTEEAE* |
| Ga0157296_102167662 | 3300012905 | Soil | ETRAGNVSVYVQNSEPGARDQAPAEISWSPDSTFVVDSTEEAE* |
| Ga0162650_1000834501 | 3300012939 | Soil | AGNVSLYVQNSEPGARDQAPSDISWSPDSTFVVDSTEGAE* |
| Ga0164302_118233721 | 3300012961 | Soil | NVSVYVQNSEPGAADQAPTQISWSPDSTFVVDSTEEAE* |
| Ga0164305_109894512 | 3300012989 | Soil | TQYVLETRAGNVSVYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGAEA* |
| Ga0157371_103491791 | 3300013102 | Corn Rhizosphere | SVYVQNSEPGAAEQAPSKISWSPDSTFVVDSMEGAE* |
| Ga0120149_10456271 | 3300014058 | Permafrost | YVQNSEPGAQEQAPAEISWSPDSTFVVDHTEEME* |
| Ga0157380_120353371 | 3300014326 | Switchgrass Rhizosphere | YVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE* |
| Ga0134073_101194491 | 3300015356 | Grasslands Soil | GVATQYVLETKAGNISVYVQNSEPGAMQAPPSEISWSPSSTFVVDPMEGTE* |
| Ga0132255_1024619321 | 3300015374 | Arabidopsis Rhizosphere | YVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEAE* |
| Ga0134074_11444131 | 3300017657 | Grasslands Soil | NVSVYVQNSEPGAQQATPGEISWSPDSTFVVDSTEGAE |
| Ga0187785_106109652 | 3300017947 | Tropical Peatland | TQYVLETKAGNVSLYVQNSEPGARQEAPSQISWSPDSTFVVDSMEGAE |
| Ga0184610_12105302 | 3300017997 | Groundwater Sediment | VYVQNSEPGAREEAPSAISWSSDSTFVVDSTEGTE |
| Ga0187788_100706971 | 3300018032 | Tropical Peatland | VSLYVQNSEPGASQTVPSDISWSPDSTFVVDSTEGAE |
| Ga0184620_100950962 | 3300018051 | Groundwater Sediment | VGVATQYVLETRAGNVSVYVQNSEPGAREEAPSAISWSSDSTFVVDSTEGTE |
| Ga0184638_11092221 | 3300018052 | Groundwater Sediment | RAGNVSVYVQNSEPGAAEQAPSQISWSPDSTFVVDSMEGAE |
| Ga0184618_101518972 | 3300018071 | Groundwater Sediment | VLETRAGSVSVYVQNSEPGANQESPAEISWSPDSTFVVDHTEETE |
| Ga0184635_102946822 | 3300018072 | Groundwater Sediment | LETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEEAE |
| Ga0193728_13624942 | 3300019890 | Soil | VATQYVLETRAGNVSVYVQNSEPGAGPAAPSQISWSPDSTFVVDSTEGAEE |
| Ga0206356_113161141 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | SVYVQNSEPGAAEQAPSEISWSPDSTFVVDSMEGAE |
| Ga0193699_101099721 | 3300021363 | Soil | VLETRCGNVSVYVQNSEPGAAEQAPSEISWSPDSTFVVDSTEGAE |
| Ga0182009_103058821 | 3300021445 | Soil | YVGVATQYVLETQAGNISVYVQNSEPGAREESPSQISWSTDSTFVVDSTEGAEE |
| Ga0222624_14405502 | 3300021951 | Groundwater Sediment | ETRAGNVSVYVQNSEPGAREEAPSAISWSSDSTFVVDSTEGTE |
| Ga0207651_111994991 | 3300025960 | Switchgrass Rhizosphere | GNISVYVQNSEPGAAEQAPSEISWSPDSTFVVDSMEGAE |
| Ga0207668_114191211 | 3300025972 | Switchgrass Rhizosphere | YVLETRAGNVSVYVQNSDPGTRDQAPAEISWSPDSTFVVDSTEEAE |
| Ga0207702_105152231 | 3300026078 | Corn Rhizosphere | TRAGNVSVYVQNSEPGAPDAAPSEISWSPDSTFVVDSMEGAEA |
| Ga0209473_11945591 | 3300026330 | Soil | YVLETKAGNISVYVQNSEPGATQAPPSEISWSPSSTFVVDPMEGTE |
| Ga0209474_100061871 | 3300026550 | Soil | ETKTGNISVYVQNSEPGATQVTPSEISWSPDSTFVVDSTEGTE |
| Ga0209074_100172591 | 3300027787 | Agricultural Soil | YVLETRSGNVSVYVQNSEPGAAEQAPSKISWSPDSTFVVDSMEGAE |
| Ga0247683_10096542 | 3300027991 | Soil | TRAGNVSVYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGAEA |
| Ga0247749_10529222 | 3300027993 | Soil | SVYVQNSEPGARDQAPAEISWSPDSTFVVDSTEEAE |
| Ga0247689_10217121 | 3300028281 | Soil | NVSVYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGAEA |
| Ga0307285_100425182 | 3300028712 | Soil | YVLETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE |
| Ga0307285_101395832 | 3300028712 | Soil | TQYVLETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE |
| Ga0307311_100331642 | 3300028716 | Soil | VLETRAGNVSVYVQNSEPGAREEAPSAISWSSDSTFVVDSTEGTE |
| Ga0307311_102721011 | 3300028716 | Soil | VATQYVLETRAGNVSVYVQNSEPGAEQAAPSDISWRPASTFVVDFTEGAE |
| Ga0307316_101131041 | 3300028755 | Soil | ISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE |
| Ga0307323_100078435 | 3300028787 | Soil | GNISVYVQNSEPARSQIAPGEISWSSDSTFVVDSTEGAE |
| Ga0307323_102921342 | 3300028787 | Soil | TRAGNISVYVQNSEPGTQQAAPSEISWSPDSTFVVDSTEGAEAE |
| Ga0307294_100707122 | 3300028810 | Soil | NISIYVQNSEPGASDQAPSEISWSPDSTFVVDHTEGVE |
| Ga0307294_100967581 | 3300028810 | Soil | NISVYVQNSEPGARDHAPSEISWSPDSTFVVDSTEEAE |
| Ga0307314_101223311 | 3300028872 | Soil | VLETGAGSISIYVQNSEPGASDQAPSEISWSPDSTFVVDHTEGVE |
| Ga0307286_100789391 | 3300028876 | Soil | VLETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE |
| Ga0307277_103550962 | 3300028881 | Soil | GVATQYVLETKSGNVSVYVQNSEPGAAEQAPSQISWSPDSTFVVDSMEGAE |
| Ga0308189_101168761 | 3300031058 | Soil | VATQYVLETKAGNVSVYVQNSEPGAALAAPSQISWSPDSTFVVDSMEGAEE |
| Ga0308201_103454231 | 3300031091 | Soil | TKAGNVSVYVQNSEPGAALAAPSQISWSPDSTFVVDSMEGAEE |
| Ga0308197_102998841 | 3300031093 | Soil | GNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE |
| Ga0308187_100178691 | 3300031114 | Soil | TQYVLETKSGNVSVYVQNSEPGAAEQAPSQISWSPDSTFVVDSMEGAE |
| Ga0308187_100227723 | 3300031114 | Soil | ETRAGNISVYVQNSEPARSQIAPGEISWSPDSTFVVDSTEGAE |
| Ga0308194_100367232 | 3300031421 | Soil | VSVYVQNSEPGAALAAPSQISWSPDSTFVVDSMEGAEE |
| Ga0314786_005120_2_112 | 3300034664 | Soil | VYVQNSEPGVAEQAPSEISWSPDSTFVVDSTEGAEA |
| Ga0314796_029736_13_123 | 3300034671 | Soil | VYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGAEA |
| Ga0314799_021098_584_691 | 3300034674 | Soil | YVQNSEPGAPDAAPSEISWSPDSTFVVDSMEGAEA |
| Ga0314801_003980_1_153 | 3300034676 | Soil | ATQYVLETRAGNVSVYVQNSEPGAPDAAPSDISWSPDSTFVVDSMEGVEA |
| ⦗Top⦘ |