| Basic Information | |
|---|---|
| Family ID | F103158 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RRAGFAVDLCLAIIADRDAYPDWILPSIPDRVDRLPYEDDDED |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.06 % |
| % of genes from short scaffolds (< 2000 bps) | 91.09 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (88.119 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (18.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.366 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.436 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.54% β-sheet: 0.00% Coil/Unstructured: 77.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 2.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000525|JGI1221J11331_1007618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3069 | Open in IMG/M |
| 3300001282|B570J14230_10173965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300002092|JGI24218J26658_1013048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1295 | Open in IMG/M |
| 3300003491|JGI25924J51412_1004939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2580 | Open in IMG/M |
| 3300004804|Ga0007796_10244481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300005527|Ga0068876_10481424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300005662|Ga0078894_10647572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
| 3300006637|Ga0075461_10236312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300006802|Ga0070749_10302675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300006805|Ga0075464_10727011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300006805|Ga0075464_10895095 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300007540|Ga0099847_1216641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300008072|Ga0110929_1136040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300008107|Ga0114340_1269661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300008108|Ga0114341_10326221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
| 3300008117|Ga0114351_1019942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8001 | Open in IMG/M |
| 3300008266|Ga0114363_1195934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300008267|Ga0114364_1049976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1506 | Open in IMG/M |
| 3300008339|Ga0114878_1092029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1186 | Open in IMG/M |
| 3300008450|Ga0114880_1082928 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
| 3300009026|Ga0102829_1053564 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
| 3300009068|Ga0114973_10024879 | All Organisms → Viruses → Predicted Viral | 3679 | Open in IMG/M |
| 3300009081|Ga0105098_10279848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300009085|Ga0105103_10442523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300009163|Ga0114970_10594768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300009164|Ga0114975_10307332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300009165|Ga0105102_10898851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300009183|Ga0114974_10291630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300009184|Ga0114976_10519849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
| 3300009194|Ga0114983_1108656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300009450|Ga0127391_1022330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
| 3300009559|Ga0130029_1008237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| 3300010157|Ga0114964_10135173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1205 | Open in IMG/M |
| 3300010885|Ga0133913_12288324 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| 3300011010|Ga0139557_1047285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
| 3300012286|Ga0157137_106481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300013005|Ga0164292_10545145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
| 3300017707|Ga0181363_1023288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1204 | Open in IMG/M |
| 3300017716|Ga0181350_1034371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1387 | Open in IMG/M |
| 3300017774|Ga0181358_1163803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
| 3300017777|Ga0181357_1250064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300017777|Ga0181357_1320244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300017778|Ga0181349_1201447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300017780|Ga0181346_1066966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1432 | Open in IMG/M |
| 3300017780|Ga0181346_1116429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
| 3300019784|Ga0181359_1192047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300019784|Ga0181359_1241451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300020161|Ga0211726_10396738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300020161|Ga0211726_10598581 | All Organisms → Viruses → Predicted Viral | 2099 | Open in IMG/M |
| 3300020162|Ga0211735_11100875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3834 | Open in IMG/M |
| 3300022407|Ga0181351_1198333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300022407|Ga0181351_1247600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300024348|Ga0244776_10198278 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300025075|Ga0209615_102700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
| 3300025436|Ga0208103_1027500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300025595|Ga0208248_1141122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300025606|Ga0207954_1154264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300027212|Ga0208554_1011973 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1129794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
| 3300027763|Ga0209088_10359636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300027764|Ga0209134_10249325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300027777|Ga0209829_10135395 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
| 3300027785|Ga0209246_10185934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
| 3300027836|Ga0209230_10560306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300027956|Ga0209820_1210561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300027963|Ga0209400_1124595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
| 3300027969|Ga0209191_1001223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17224 | Open in IMG/M |
| 3300027969|Ga0209191_1049116 | All Organisms → Viruses → Predicted Viral | 1937 | Open in IMG/M |
| 3300027969|Ga0209191_1169571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300027969|Ga0209191_1275013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1282808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300028025|Ga0247723_1021239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2183 | Open in IMG/M |
| 3300028025|Ga0247723_1027430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1836 | Open in IMG/M |
| 3300031578|Ga0307376_10673618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300031669|Ga0307375_10322190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| 3300031787|Ga0315900_10723883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
| 3300031787|Ga0315900_10892880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300031787|Ga0315900_11085612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300031857|Ga0315909_10782212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300031885|Ga0315285_10643358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300032050|Ga0315906_10809799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
| 3300032093|Ga0315902_10915644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
| 3300032093|Ga0315902_11217854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300032116|Ga0315903_10118359 | All Organisms → Viruses → Predicted Viral | 2493 | Open in IMG/M |
| 3300032116|Ga0315903_10666358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300033816|Ga0334980_0210407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
| 3300033993|Ga0334994_0117477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1539 | Open in IMG/M |
| 3300033996|Ga0334979_0086862 | All Organisms → Viruses → Predicted Viral | 1967 | Open in IMG/M |
| 3300034012|Ga0334986_0479683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300034061|Ga0334987_0524693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300034092|Ga0335010_0530567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300034092|Ga0335010_0645762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300034101|Ga0335027_0194908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
| 3300034101|Ga0335027_0455967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
| 3300034104|Ga0335031_0829401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300034106|Ga0335036_0264805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
| 3300034106|Ga0335036_0447350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300034111|Ga0335063_0381444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
| 3300034118|Ga0335053_0354282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300034120|Ga0335056_0414116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
| 3300034284|Ga0335013_0381956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.86% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.91% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.95% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.97% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.97% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.98% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.99% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.99% |
| Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.99% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.99% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.99% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.99% |
| Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.99% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.99% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000525 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009559 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 3m; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012286 | Freshwater microbial communities from Ausable River, Ontario, Canada - S47 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025606 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1221J11331_10076186 | 3300000525 | Hypersaline | MYTSLRKAGLSVEISLAIIVEPGAYPDWILPSIPDRVDRIPYEDDDED* |
| B570J14230_101739652 | 3300001282 | Freshwater | KSLRRAGFAVDLCLAIIVDKDAYPDWILPSIPDRVDRLPYEDDDED* |
| JGI24218J26658_10130481 | 3300002092 | Lentic | LNEWYKSLRKAGFSTDMALGIIVEKDSFPDWILPKLPNRIDNIPYDDEDDD* |
| JGI25924J51412_10049397 | 3300003491 | Freshwater Lake | RAGFAVDLCLAIITDQDSYPDWIIPNLPALPPIPYEDDDDEDE* |
| Ga0007796_102444811 | 3300004804 | Freshwater | ITLNEMYKALRRSGFAIDIALAIIVDRDAYPDWILPSLPNRIDNIPYDDEDDD* |
| Ga0068876_104814241 | 3300005527 | Freshwater Lake | LCLSIIQDRDAYPDWILPSIPDRVDRIPYEDDDDED* |
| Ga0078894_106475721 | 3300005662 | Freshwater Lake | ALGIIMERDAYPDWILPALPNRIDNIPYEDEDDD* |
| Ga0075461_102363122 | 3300006637 | Aqueous | FGVDIALGIIMERDAYPDWILPALPNRIDNIPYEDEDDD* |
| Ga0070749_103026751 | 3300006802 | Aqueous | MHEFYKALRKAGFAVDLCLAIIVERSAYPDWILPELPNRIDSIPYEVDDED* |
| Ga0075464_107270111 | 3300006805 | Aqueous | RRAGFGVDIALGIIMERDAYPDWILPNLPNRIDNIPYEDDDED* |
| Ga0075464_108950951 | 3300006805 | Aqueous | RAGFAVDVCLAIITDRDAYPDWLMPSIPDRVDRLPYEDDDED* |
| Ga0099847_12166411 | 3300007540 | Aqueous | GLHEMYRALRRAGFGVDIALGIIMERDAYPDWILPSLPNRIDNIPYEDEEDD* |
| Ga0110929_11360401 | 3300008072 | Water Bodies | FYKSLRRAGFSVDIALAIIVEPSAYPDWILPSLPNKIDPMPYEDDDED* |
| Ga0114340_12696611 | 3300008107 | Freshwater, Plankton | VDISLALISDKDAYPDWILPSIPDRVDRIPYEDDDED* |
| Ga0114341_103262212 | 3300008108 | Freshwater, Plankton | LHEMYRALRRAGFAVDICLAIISDRDAYPDWILPSIPDRVDRLPYEDDDED* |
| Ga0114351_10199429 | 3300008117 | Freshwater, Plankton | MAKKKVLAIITDRDAYPDWILPTLPNRIDNIPYDDDDED* |
| Ga0114363_11959341 | 3300008266 | Freshwater, Plankton | RAGFACDLALSIIQDRDAYPDWILPSIPDRVDRIPYEDDDED* |
| Ga0114364_10499763 | 3300008267 | Freshwater, Plankton | MYRALIRAGFRSDIAMGLIVDKDIYPDWILPSLPNRIDNIPYDDEDDD* |
| Ga0114878_10920293 | 3300008339 | Freshwater Lake | MYRALRRAGFAVDIALSIIQDRDAYPDWILPSIPDRVDRLPYEDDEDED* |
| Ga0114880_10829281 | 3300008450 | Freshwater Lake | DAWAISLHEMYRALRRAGFPVDMCLAIITDRDAYPDWILPSIPDRVDRLPYEDDDED* |
| Ga0102829_10535641 | 3300009026 | Estuarine | VDLCLAIITDRDSYPEWILPSIPDRMDPIPYEDDDED* |
| Ga0114973_100248791 | 3300009068 | Freshwater Lake | ALRRAGFAVDLCLAIITDRDAYPDWALPELPNRIDNIPYDDEDDD* |
| Ga0105098_102798482 | 3300009081 | Freshwater Sediment | AVDLCLAIIVERSAYPDWLLPSIPDRVDRLPYEDDEED* |
| Ga0105103_104425231 | 3300009085 | Freshwater Sediment | RALRRAGFAVDVALSIIQDKDAYPDWILPSIPDRVDRLPYEDDEDED* |
| Ga0114970_105947681 | 3300009163 | Freshwater Lake | MCLAIITDRDSYPEWIMPSIPDRMDPIPYEDDDED* |
| Ga0114975_103073321 | 3300009164 | Freshwater Lake | RSGFAVDLCLAIITDPGAYPDWILPALPNRIDNIPYDDDDED* |
| Ga0105102_108988511 | 3300009165 | Freshwater Sediment | CLAIITDKDAYPDWILPSIPDRVDRLPYEDDDED* |
| Ga0114974_102916301 | 3300009183 | Freshwater Lake | RRAGFAVDLCLAIITDRDAYPDWALPELPNRIDNIPYDDEDDD* |
| Ga0114976_105198492 | 3300009184 | Freshwater Lake | WAISLHEMYRALRRAGFAVDMCLAIIADRDAYPDWILPSIPDRVDRLPYEDDEDED* |
| Ga0114983_11086562 | 3300009194 | Deep Subsurface | DIALGIIMERDAYPDWILPALPNRIDNIPYEDEDDD* |
| Ga0127391_10223303 | 3300009450 | Meromictic Pond | IALNEWYKSLRKAGFSVDIALGIIVEKDAFPDWILPTIPNKIDTQPYEDDEED* |
| Ga0130029_10082372 | 3300009559 | Meromictic Pond | VDLCLAIITDRDAYPDWALPELPNRLDRIPYDEDDDD* |
| Ga0114964_101351731 | 3300010157 | Freshwater Lake | WAITLNEMYKALRRSGFAVDIALAIIVDRDAYPDWILPSLPNRIDNIPYDDEDDD* |
| Ga0133913_122883244 | 3300010885 | Freshwater Lake | ALRRAGFAVDLCLAIITDRDAYPDWALPQLPNRIDNIPYDDEDDD* |
| Ga0139557_10472851 | 3300011010 | Freshwater | AMGLIVDKDIYPDWILPSLPNRIDNIPYDDEDDD* |
| Ga0157137_1064811 | 3300012286 | Freshwater | ALRRAGFAVDLCLAIITDPQAYPDWILPKLPNKIDPMPYEDDDED* |
| Ga0164292_105451451 | 3300013005 | Freshwater | YKALRRAGFAVDMCLAIIVERSAYPDWVLPELPNRIDNIPYEDEDDD* |
| Ga0181363_10232883 | 3300017707 | Freshwater Lake | LCLAIITDREAYPDWLMPSIPDRVDRLPYEDDDED |
| Ga0181350_10343714 | 3300017716 | Freshwater Lake | YRALIRAGFRSDIAMGLIVDKEVYPDWILPSLPNRIDNIPYDDEDDD |
| Ga0181358_11638031 | 3300017774 | Freshwater Lake | RSDIAMGLIVDKEVYPDWILPSLPNRIDNIPYDDEDDD |
| Ga0181357_12500642 | 3300017777 | Freshwater Lake | LIRAGFRSDIAMGLIVDKEVYPDWILPSLPNRIDNIPYDDEDDD |
| Ga0181357_13202442 | 3300017777 | Freshwater Lake | DAYAISMNEFYKALRRAGFAFDLCLAIITDRDAYPDWALPELPNRIDNIPYDDEDDD |
| Ga0181349_12014471 | 3300017778 | Freshwater Lake | KALRRAGFAVDLCLAIITDRDAYPDWALPELPNRIDNIPYDDEDDD |
| Ga0181346_10669664 | 3300017780 | Freshwater Lake | YRALRRAGFAVDLCLAIITDREAYPGWIEPRMPDWVERPPYQDDDDED |
| Ga0181346_11164292 | 3300017780 | Freshwater Lake | DISLALISDKDAYPDWILPSIPDRVDRIPYEDDDED |
| Ga0181359_11920471 | 3300019784 | Freshwater Lake | SENHAFWIIADRDAYPDWLLPTLPNKIDADPYEDDDED |
| Ga0181359_12414511 | 3300019784 | Freshwater Lake | SDIAMGLIVDKEVYPDWILPSLPNRIDNIPYDDEDDD |
| Ga0211726_103967382 | 3300020161 | Freshwater | LDQWAISLHEMYRALRRAGFAVDLCLAIISDRDSYPDWILPSIPDRVDRLPYEDDDED |
| Ga0211726_105985814 | 3300020161 | Freshwater | LDQWAISLHEMYRALRRAGFAVDLCLAIISDRDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0211735_111008759 | 3300020162 | Freshwater | YAISMHEFYKALRRAGFAVDLCLAIITDRDAYPDWLLPSIPDRVDRLPYEDDDED |
| Ga0181351_11983331 | 3300022407 | Freshwater Lake | WAISLHEMYRALIRAGFRSDIAMGLIVDKDIYPDWILPSLPNRIDNIPYDDEDDD |
| Ga0181351_12476001 | 3300022407 | Freshwater Lake | ISLHEMYRALIRAGFRSDIAMGLIVDKEVYPDWILPSLPNRIDNIPYDDEDDD |
| Ga0244776_101982781 | 3300024348 | Estuarine | LHEMYRALRRAGFAVDMCLAIIADRDAYPDWILPSIPDRVDRLPYEDDEDED |
| Ga0209615_1027001 | 3300025075 | Freshwater | AISLQEMYRALRRAGMSVDIALAIIVEPSAYPDWILPPLPNKIDPLPYEDDDED |
| Ga0208103_10275002 | 3300025436 | Freshwater | LDAWAISLHEMYRALIRAGFSGSTALSLIMEKDAYPDWILPAIPNRIDNIPYDDEDDD |
| Ga0208248_11411221 | 3300025595 | Freshwater | YKALRRSGFAVDIALAIIVDRDAYPDWILPSLPNRIDNIPYDDEDDD |
| Ga0207954_11542642 | 3300025606 | Freshwater | ALDAWAISLHEMYRALIRAGFSGSTALSLIMEKDAYPDWILPAIPNRIDNIPYDDEDDD |
| Ga0208554_10119735 | 3300027212 | Estuarine | RRAGFAVDMCLAIIADRDAYPDWILPSIPDRVDRLPYEDDEDED |
| (restricted) Ga0247833_11297942 | 3300027730 | Freshwater | KSLRRAGFAVDLCLAIITDRDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0209088_103596361 | 3300027763 | Freshwater Lake | AVDLCLAIITDRDAYPDWALPELPNRIDNIPYDDEDDD |
| Ga0209134_102493251 | 3300027764 | Freshwater Lake | AADIALSMIQDKLSYPDWILPSIPNKIDNIPYEDDED |
| Ga0209829_101353951 | 3300027777 | Freshwater Lake | SGFAIDIALAIIVDRDAYPDWIVPSLPNRIDNIPYDDEDDD |
| Ga0209246_101859341 | 3300027785 | Freshwater Lake | DLCLSIIQDPDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0209230_105603062 | 3300027836 | Freshwater And Sediment | AGFAVDLALAIITDPQAYPDWILPSLPNQIDPLPYEDDDED |
| Ga0209820_12105611 | 3300027956 | Freshwater Sediment | YAISMHEFYKSLRRAGFAVDLCLAIITDKDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0209400_11245953 | 3300027963 | Freshwater Lake | CMHEFYKSLRRAGFAVDVCLAIITDRDAYPDWLMPSIPDRVDRLPYEDDDED |
| Ga0209191_100122333 | 3300027969 | Freshwater Lake | RRSGFAVDLCLAIITDPGAYPDWILPALPNRIDNIPYEDDDED |
| Ga0209191_10491161 | 3300027969 | Freshwater Lake | SWAITLNEMYKALRRSGFAIDIALAIIVDRDAYPDWILPSLPNRIDNIPYDDEDDD |
| Ga0209191_11695712 | 3300027969 | Freshwater Lake | RSGFAVDLCLAIITDPGAYPDWILPALPNRIDNIPYDDDDED |
| Ga0209191_12750131 | 3300027969 | Freshwater Lake | MCVAIITDRDSYPDWIMPSIPDRMDPIPYEDDDED |
| (restricted) Ga0247834_12828081 | 3300027977 | Freshwater | DAYAISMHEFYKSLRRAGFAVDLCLAIITDRDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0247723_10212391 | 3300028025 | Deep Subsurface Sediment | FYKSLRRAGFAVDLCLAIITDRDAYPDWLMPSIPDRVDRLPYEDDDED |
| Ga0247723_10274301 | 3300028025 | Deep Subsurface Sediment | LRRSGFAVDLCLAIITDRDAYPDWILPNLPNRIDNLPYEDDDED |
| Ga0307376_106736182 | 3300031578 | Soil | MYRALRRAGFAVDVSLYLISEKDAYPDWILPSIPDRVDRIPYEDDDED |
| Ga0307375_103221901 | 3300031669 | Soil | DAWAISLHEMYRALRRAGFAVDVSLYLISEKDAYPDWILPSIPDRVDRIPYEDDDED |
| Ga0315900_107238832 | 3300031787 | Freshwater | RAGFAVDVCLAIITDREAYPDWLMPSIPDRVDRLPYEDDDED |
| Ga0315900_108928802 | 3300031787 | Freshwater | AVDLCLGIITERGAYPDWLMPSIPDRVDRLPYEDDDED |
| Ga0315900_110856121 | 3300031787 | Freshwater | AVDLCLAIISDRDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0315909_107822122 | 3300031857 | Freshwater | GFAVDLCLAIITDRDAYPDWLMPSIPDRVDRLPYEDDDED |
| Ga0315285_106433582 | 3300031885 | Sediment | GFAVDLCLAIITDRDSYPDWIIPNLPALPPIPYEDDDDEDE |
| Ga0315906_108097991 | 3300032050 | Freshwater | LHEMYRALRRAGSAVDIALSIIQDPDAYPEWILPSIPDRVDRLPYEDDDED |
| Ga0315902_109156441 | 3300032093 | Freshwater | QWAISLHEMYRALRRAGFAVDISLALISDKDAYPDWILPSIPDRVDRIPYEDDDED |
| Ga0315902_112178542 | 3300032093 | Freshwater | ALRRAGFACDLALSIIQDRDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0315903_101183591 | 3300032116 | Freshwater | AVDICLAIISDRDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0315903_106663582 | 3300032116 | Freshwater | LDAWAIGLHEMYRALRRAGFAVDIALSIIQDRDAYPEWILPSIPDRVDRLPYEDDDED |
| Ga0334980_0210407_647_778 | 3300033816 | Freshwater | RAGFAVDLCLAIISDRDAYPDWILPSIPDRVDRIPYEDDDDED |
| Ga0334994_0117477_1424_1537 | 3300033993 | Freshwater | VDLCLAIIADRDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0334979_0086862_32_178 | 3300033996 | Freshwater | MYSSLRRAGFGVDIALGIIMERDAYPDWILPALPNRIDNIPYEDEDDD |
| Ga0334986_0479683_2_112 | 3300034012 | Freshwater | DLCLAIITDRDAYPDWLMPSIPDRVDRLPYEDDDED |
| Ga0334987_0524693_2_121 | 3300034061 | Freshwater | FAVDLCLAIITDRDSYPAWILPSIPDRMDPIPYEDDDED |
| Ga0335010_0530567_462_611 | 3300034092 | Freshwater | MYRALRRAGFAVDLCLAIIADRDAYPDWILPSIPDRVDRIPYEDDDDED |
| Ga0335010_0645762_397_528 | 3300034092 | Freshwater | RRAGFAVDLCLAIIADRDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0335027_0194908_16_162 | 3300034101 | Freshwater | MYRALRRAGFAVDMCLAIITDQDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0335027_0455967_678_812 | 3300034101 | Freshwater | LRRAGFAVDMCLAIITDQDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0335031_0829401_14_160 | 3300034104 | Freshwater | MYRALRRAGFAVDLCLSIIQDRDAYPDWILPSIPDRVDRIPYEDDDED |
| Ga0335036_0264805_5_151 | 3300034106 | Freshwater | MYKALRRAGMSIDIALAIIVEPTAYPDWILPKLPNQIDPLPYDDDDED |
| Ga0335036_0447350_3_134 | 3300034106 | Freshwater | RRAGFAVDMALAIITDVDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0335063_0381444_1_123 | 3300034111 | Freshwater | GFAVDLCLAIITDREAYPDWLMPSIPDRVDRLPYEDDDED |
| Ga0335053_0354282_761_904 | 3300034118 | Freshwater | YRALRRAGFAVDLCLAIISDRDAYPDWILPSIPDRVDRLPYEDDDED |
| Ga0335056_0414116_1_159 | 3300034120 | Freshwater | LHEMYRALRRAGFAVDLCLAIISDRDAYPDWILPSIPDRVDRIPYEDDDDED |
| Ga0335013_0381956_2_145 | 3300034284 | Freshwater | YRALRRAGFAVDLCLAIITDRDSYPAWILPSIPDRMDPIPYEDDDED |
| ⦗Top⦘ |