| Basic Information | |
|---|---|
| Family ID | F103146 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MSEPRYLMGDDYALNGVEGEEEETGDAGLPDRMWEDED |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 74.26 % |
| % of genes near scaffold ends (potentially truncated) | 7.92 % |
| % of genes from short scaffolds (< 2000 bps) | 65.35 % |
| Associated GOLD sequencing projects | 58 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.535 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.713 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.337 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.218 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.58% β-sheet: 0.00% Coil/Unstructured: 92.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 22.77 |
| PF00145 | DNA_methylase | 5.94 |
| PF07659 | DUF1599 | 3.96 |
| PF08281 | Sigma70_r4_2 | 2.97 |
| PF13578 | Methyltransf_24 | 2.97 |
| PF09723 | Zn-ribbon_8 | 1.98 |
| PF03796 | DnaB_C | 0.99 |
| PF07275 | ArdA | 0.99 |
| PF04545 | Sigma70_r4 | 0.99 |
| PF00565 | SNase | 0.99 |
| PF13230 | GATase_4 | 0.99 |
| PF12705 | PDDEXK_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 5.94 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.99 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.99 |
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.47 % |
| Unclassified | root | N/A | 46.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109847501 | Not Available | 1627 | Open in IMG/M |
| 3300002835|B570J40625_101400974 | Not Available | 577 | Open in IMG/M |
| 3300003411|JGI25911J50253_10211698 | Not Available | 532 | Open in IMG/M |
| 3300005517|Ga0070374_10040891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2407 | Open in IMG/M |
| 3300005517|Ga0070374_10041770 | Not Available | 2381 | Open in IMG/M |
| 3300005517|Ga0070374_10208553 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
| 3300005517|Ga0070374_10238729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
| 3300005517|Ga0070374_10461121 | Not Available | 636 | Open in IMG/M |
| 3300005527|Ga0068876_10020648 | All Organisms → Viruses → Predicted Viral | 4169 | Open in IMG/M |
| 3300005527|Ga0068876_10026064 | All Organisms → Viruses → Predicted Viral | 3663 | Open in IMG/M |
| 3300005527|Ga0068876_10088776 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300005581|Ga0049081_10027121 | Not Available | 2175 | Open in IMG/M |
| 3300005581|Ga0049081_10117364 | Not Available | 986 | Open in IMG/M |
| 3300005584|Ga0049082_10109031 | Not Available | 969 | Open in IMG/M |
| 3300005584|Ga0049082_10267015 | Not Available | 576 | Open in IMG/M |
| 3300006639|Ga0079301_1028289 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300006805|Ga0075464_10365107 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300007992|Ga0105748_10305170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 676 | Open in IMG/M |
| 3300008107|Ga0114340_1011077 | All Organisms → Viruses → Predicted Viral | 4473 | Open in IMG/M |
| 3300008107|Ga0114340_1016324 | All Organisms → Viruses → Predicted Viral | 3552 | Open in IMG/M |
| 3300008107|Ga0114340_1227895 | Not Available | 591 | Open in IMG/M |
| 3300008107|Ga0114340_1236846 | Not Available | 570 | Open in IMG/M |
| 3300008110|Ga0114343_1056612 | Not Available | 2399 | Open in IMG/M |
| 3300008110|Ga0114343_1114587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
| 3300008110|Ga0114343_1161244 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300008110|Ga0114343_1228960 | Not Available | 514 | Open in IMG/M |
| 3300008111|Ga0114344_1225945 | Not Available | 566 | Open in IMG/M |
| 3300008114|Ga0114347_1004549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7910 | Open in IMG/M |
| 3300008114|Ga0114347_1029784 | All Organisms → cellular organisms → Bacteria | 2481 | Open in IMG/M |
| 3300008114|Ga0114347_1069570 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
| 3300008116|Ga0114350_1005306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10354 | Open in IMG/M |
| 3300008116|Ga0114350_1010902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5437 | Open in IMG/M |
| 3300008116|Ga0114350_1071125 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300008259|Ga0114841_1248631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 583 | Open in IMG/M |
| 3300008266|Ga0114363_1009050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5938 | Open in IMG/M |
| 3300008266|Ga0114363_1173026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 693 | Open in IMG/M |
| 3300008266|Ga0114363_1178516 | Not Available | 676 | Open in IMG/M |
| 3300008448|Ga0114876_1169132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300009068|Ga0114973_10588682 | Not Available | 571 | Open in IMG/M |
| 3300009082|Ga0105099_10683944 | Not Available | 635 | Open in IMG/M |
| 3300009155|Ga0114968_10077152 | All Organisms → Viruses → Predicted Viral | 2077 | Open in IMG/M |
| 3300009161|Ga0114966_10103304 | All Organisms → Viruses → Predicted Viral | 1913 | Open in IMG/M |
| 3300009180|Ga0114979_10140363 | Not Available | 1482 | Open in IMG/M |
| 3300009183|Ga0114974_10057956 | Not Available | 2574 | Open in IMG/M |
| 3300009183|Ga0114974_10775159 | Not Available | 516 | Open in IMG/M |
| 3300009184|Ga0114976_10382062 | Not Available | 739 | Open in IMG/M |
| 3300010160|Ga0114967_10027861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3833 | Open in IMG/M |
| 3300011115|Ga0151514_10184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 30769 | Open in IMG/M |
| 3300013372|Ga0177922_10100833 | Not Available | 540 | Open in IMG/M |
| 3300013372|Ga0177922_10929098 | Not Available | 597 | Open in IMG/M |
| 3300017723|Ga0181362_1036117 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
| 3300017723|Ga0181362_1091582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 608 | Open in IMG/M |
| 3300017736|Ga0181365_1065871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
| 3300017777|Ga0181357_1243302 | Not Available | 627 | Open in IMG/M |
| 3300017778|Ga0181349_1002556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7812 | Open in IMG/M |
| 3300017778|Ga0181349_1134420 | Not Available | 901 | Open in IMG/M |
| 3300017780|Ga0181346_1254097 | Not Available | 613 | Open in IMG/M |
| 3300017784|Ga0181348_1146095 | Not Available | 889 | Open in IMG/M |
| 3300019784|Ga0181359_1008186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3602 | Open in IMG/M |
| 3300019784|Ga0181359_1077893 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
| 3300019784|Ga0181359_1160097 | Not Available | 763 | Open in IMG/M |
| 3300019784|Ga0181359_1187173 | Not Available | 678 | Open in IMG/M |
| 3300020159|Ga0211734_10560816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300020159|Ga0211734_11277619 | Not Available | 949 | Open in IMG/M |
| 3300020161|Ga0211726_11060716 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
| 3300020533|Ga0208364_1000044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33490 | Open in IMG/M |
| 3300020560|Ga0208852_1005101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 2997 | Open in IMG/M |
| 3300021963|Ga0222712_10013610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7150 | Open in IMG/M |
| 3300021963|Ga0222712_10369230 | Not Available | 880 | Open in IMG/M |
| 3300022190|Ga0181354_1014874 | Not Available | 2379 | Open in IMG/M |
| 3300022190|Ga0181354_1167032 | Not Available | 678 | Open in IMG/M |
| 3300022407|Ga0181351_1066405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
| 3300022752|Ga0214917_10012067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7888 | Open in IMG/M |
| 3300023184|Ga0214919_10585151 | Not Available | 663 | Open in IMG/M |
| 3300027114|Ga0208009_1081381 | Not Available | 541 | Open in IMG/M |
| 3300027563|Ga0209552_1143048 | Not Available | 619 | Open in IMG/M |
| 3300027608|Ga0208974_1009801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3141 | Open in IMG/M |
| 3300027734|Ga0209087_1306149 | Not Available | 564 | Open in IMG/M |
| 3300027754|Ga0209596_1165683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 970 | Open in IMG/M |
| 3300027759|Ga0209296_1304071 | Not Available | 632 | Open in IMG/M |
| 3300027759|Ga0209296_1390337 | Not Available | 524 | Open in IMG/M |
| 3300027764|Ga0209134_10091906 | Not Available | 1034 | Open in IMG/M |
| 3300027764|Ga0209134_10202068 | Not Available | 684 | Open in IMG/M |
| 3300027770|Ga0209086_10264124 | Not Available | 753 | Open in IMG/M |
| 3300027816|Ga0209990_10017134 | All Organisms → Viruses → Predicted Viral | 4187 | Open in IMG/M |
| 3300027816|Ga0209990_10174923 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300028025|Ga0247723_1006179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5273 | Open in IMG/M |
| 3300028025|Ga0247723_1006352 | Not Available | 5182 | Open in IMG/M |
| 3300028025|Ga0247723_1080740 | Not Available | 856 | Open in IMG/M |
| 3300031758|Ga0315907_10014058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7707 | Open in IMG/M |
| 3300031758|Ga0315907_10024743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5499 | Open in IMG/M |
| 3300031758|Ga0315907_10033830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4590 | Open in IMG/M |
| 3300031784|Ga0315899_10007696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11574 | Open in IMG/M |
| 3300031787|Ga0315900_10316298 | All Organisms → Viruses → Predicted Viral | 1283 | Open in IMG/M |
| 3300031857|Ga0315909_10026583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5702 | Open in IMG/M |
| 3300031857|Ga0315909_10732628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440 | 636 | Open in IMG/M |
| 3300031951|Ga0315904_10007114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15097 | Open in IMG/M |
| 3300031951|Ga0315904_10336996 | Not Available | 1395 | Open in IMG/M |
| 3300033993|Ga0334994_0340624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 746 | Open in IMG/M |
| 3300034062|Ga0334995_0042962 | Not Available | 3759 | Open in IMG/M |
| 3300034092|Ga0335010_0181159 | Not Available | 1304 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.71% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 18.81% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.94% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.97% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.97% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.98% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.99% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.99% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.99% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1098475015 | 3300002408 | Freshwater | MAEPRYLMGDDYALNGVEGEEEIGDTGLPDRMWEDED* |
| B570J40625_1014009741 | 3300002835 | Freshwater | MTMSEPMYLMGDDYALKGDESDVDENDDSGLPDRMWEDDV* |
| JGI25911J50253_102116982 | 3300003411 | Freshwater Lake | VRERGSGPMAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMSEDED* |
| Ga0070374_100408915 | 3300005517 | Freshwater Lake | MSEPMYLMGDEFALKGEEEDEDDSGLPDRMWEDDL* |
| Ga0070374_100417702 | 3300005517 | Freshwater Lake | MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMSEDED* |
| Ga0070374_102085534 | 3300005517 | Freshwater Lake | VSEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED* |
| Ga0070374_102387293 | 3300005517 | Freshwater Lake | MSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE* |
| Ga0070374_104611211 | 3300005517 | Freshwater Lake | MGEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE* |
| Ga0068876_100206485 | 3300005527 | Freshwater Lake | MSEPMYLMGDDYALNGTEDDVDENDTGLPDRMWEDDE* |
| Ga0068876_100260648 | 3300005527 | Freshwater Lake | MSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEDA* |
| Ga0068876_100887764 | 3300005527 | Freshwater Lake | MKGKHMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA* |
| Ga0049081_100271215 | 3300005581 | Freshwater Lentic | MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMWEDED* |
| Ga0049081_101173645 | 3300005581 | Freshwater Lentic | VSEPMYLMGDEFALKGEEEDEDDSGLPDRMWEDDL* |
| Ga0049082_101090312 | 3300005584 | Freshwater Lentic | VLEVWGSQLMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE* |
| Ga0049082_102670152 | 3300005584 | Freshwater Lentic | MAEPRYLFGDDYALNGVEGEEEEIGDAGLPDRMSEDED* |
| Ga0079301_10282897 | 3300006639 | Deep Subsurface | MSEPRYLEGDEYALNGIEGEEEDTGDTGLPDRMWEDEE* |
| Ga0075464_103651072 | 3300006805 | Aqueous | VSEPRYLEGDDYALNGVEGEDEDAGDTGLPDRMWEDED* |
| Ga0105748_103051702 | 3300007992 | Estuary Water | MSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA* |
| Ga0114340_101107712 | 3300008107 | Freshwater, Plankton | MKMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA* |
| Ga0114340_10163244 | 3300008107 | Freshwater, Plankton | MSEPMYLQGDDYALNGTEEDIDENDTGLPDRMWEDEDA* |
| Ga0114340_12278952 | 3300008107 | Freshwater, Plankton | LITIRRKLMPEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDED* |
| Ga0114340_12368462 | 3300008107 | Freshwater, Plankton | MKGRRMSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEDA* |
| Ga0114343_10566121 | 3300008110 | Freshwater, Plankton | MPEPRYLMGDEYALNGIEGEEEDTGDTGLPDRMWEDEE* |
| Ga0114343_11145872 | 3300008110 | Freshwater, Plankton | MSEPMYLQGDEYALKGIEGDIDEDDDSGLPDRMWEDDE* |
| Ga0114343_11612442 | 3300008110 | Freshwater, Plankton | MPEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDED* |
| Ga0114343_12289602 | 3300008110 | Freshwater, Plankton | MPEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDEE* |
| Ga0114344_12259454 | 3300008111 | Freshwater, Plankton | MKMSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEE* |
| Ga0114347_10045492 | 3300008114 | Freshwater, Plankton | MSEPMYLMGDEYALKGTEDDVDENDDSGLPDRMWEDDE* |
| Ga0114347_10297845 | 3300008114 | Freshwater, Plankton | MGEPRYLSGDEYARNGVEGEEEETGDAGLPDRMWEDED* |
| Ga0114347_10695703 | 3300008114 | Freshwater, Plankton | MKGKRMSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEDA* |
| Ga0114350_10053068 | 3300008116 | Freshwater, Plankton | MKGKHMSEPMYLQGDDYALNGTEDDIDEDDTGLPDRMWEDEDA* |
| Ga0114350_10109029 | 3300008116 | Freshwater, Plankton | MKGKHMNEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA* |
| Ga0114350_10711252 | 3300008116 | Freshwater, Plankton | MYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA* |
| Ga0114841_12486313 | 3300008259 | Freshwater, Plankton | MSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEE* |
| Ga0114363_10090508 | 3300008266 | Freshwater, Plankton | MGEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED* |
| Ga0114363_11730262 | 3300008266 | Freshwater, Plankton | MSEPMYLQGDDYALNGTEDDIDEDDTGLPDRMWEDEE* |
| Ga0114363_11785162 | 3300008266 | Freshwater, Plankton | MGEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDDE* |
| Ga0114876_11691321 | 3300008448 | Freshwater Lake | MSEPMYLQGDEYALKGIEGDIDENDDSGLPDRMWEDDE* |
| Ga0114973_105886822 | 3300009068 | Freshwater Lake | VRERRSGPMAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMWEDED* |
| Ga0105099_106839441 | 3300009082 | Freshwater Sediment | MPEPRYLEGDDYALNGVEQEDEDTGDTGEPDRMWEDEE* |
| Ga0114968_100771527 | 3300009155 | Freshwater Lake | MSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDD* |
| Ga0114966_101033046 | 3300009161 | Freshwater Lake | MSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDE* |
| Ga0114979_101403632 | 3300009180 | Freshwater Lake | VRERGSKPMAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED* |
| Ga0114974_100579566 | 3300009183 | Freshwater Lake | VRERRSGPMAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED* |
| Ga0114974_107751592 | 3300009183 | Freshwater Lake | VRERGSGPMAEPRYLMGDDYALNGVEGEEEEIGDVGLPDRMSEDED* |
| Ga0114976_103820624 | 3300009184 | Freshwater Lake | EPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED* |
| Ga0114967_100278614 | 3300010160 | Freshwater Lake | MGEPRYLSGDEYALNGVEGEEEEIGDAGLPDRMWEDED* |
| Ga0151514_101842 | 3300011115 | Freshwater | MSEPRYLEGDEAALNTEPESDDDDSGLPDRMWEDDE* |
| Ga0177922_101008333 | 3300013372 | Freshwater | MSEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED* |
| Ga0177922_109290982 | 3300013372 | Freshwater | VRERGSGPMAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMSEDED* |
| Ga0181362_10361175 | 3300017723 | Freshwater Lake | MREPMYLMGDEFALKGEEEDEGDSGLPDRMWEDDE |
| Ga0181362_10915821 | 3300017723 | Freshwater Lake | MGEPRYLMGDDYALNGVEGEEEIGDAGLPDRMGEDED |
| Ga0181365_10658712 | 3300017736 | Freshwater Lake | VLEVWGSQLMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE |
| Ga0181357_12433023 | 3300017777 | Freshwater Lake | MGEPRYLMGDDYALNGVEGEEEETGDAGLPDRMWEDDY |
| Ga0181349_100255610 | 3300017778 | Freshwater Lake | MSEPMYLQGEEYALNGTEDDVDENDTGLPDRMWEDEE |
| Ga0181349_11344205 | 3300017778 | Freshwater Lake | VSEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWE |
| Ga0181346_12540973 | 3300017780 | Freshwater Lake | PRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED |
| Ga0181348_11460955 | 3300017784 | Freshwater Lake | MGEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWE |
| Ga0181359_10081869 | 3300019784 | Freshwater Lake | MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMSEDED |
| Ga0181359_10778931 | 3300019784 | Freshwater Lake | MSEPMYLMGDEFALKGEEEDEDDSGLPDRMWEDDL |
| Ga0181359_11600973 | 3300019784 | Freshwater Lake | VSEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED |
| Ga0181359_11871734 | 3300019784 | Freshwater Lake | MSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE |
| Ga0211734_105608161 | 3300020159 | Freshwater | VSEPMYLMGDDYALKGDESDIDENDDSGLPDRMWEDEL |
| Ga0211734_112776194 | 3300020159 | Freshwater | MSEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED |
| Ga0211726_110607162 | 3300020161 | Freshwater | MSEPMYLMGDEYALKGTEDDVDENDDSGLPDRMWEDEL |
| Ga0208364_10000445 | 3300020533 | Freshwater | MKGKRMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA |
| Ga0208852_10051014 | 3300020560 | Freshwater | MAEPRYLMGDDYALNGVEGEEEIGDTGLPDRMWEDED |
| Ga0222712_1001361012 | 3300021963 | Estuarine Water | VSEPRYLMGDDYALNGVEGEEEEIGDTGLPDRMWEDED |
| Ga0222712_103692304 | 3300021963 | Estuarine Water | MSEPRYLMGDDYALNGVEGEEEETGDAGLPDRMWEDED |
| Ga0181354_101487410 | 3300022190 | Freshwater Lake | MAEPRYLFGDDYALNGVEGEEEEIGDAGLPDRMSEDED |
| Ga0181354_11670321 | 3300022190 | Freshwater Lake | MGEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED |
| Ga0181351_10664055 | 3300022407 | Freshwater Lake | VRERGSGPMAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMSEDED |
| Ga0214917_1001206714 | 3300022752 | Freshwater | MSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDE |
| Ga0214919_105851511 | 3300023184 | Freshwater | WRPIMSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDE |
| Ga0208009_10813812 | 3300027114 | Deep Subsurface | MSEPRYLEGDEYALNGIEGEEEDTGDTGLPDRMWEDEE |
| Ga0209552_11430481 | 3300027563 | Freshwater Lake | MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMWE |
| Ga0208974_10098016 | 3300027608 | Freshwater Lentic | MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMWEDED |
| Ga0209087_13061491 | 3300027734 | Freshwater Lake | MAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED |
| Ga0209596_11656833 | 3300027754 | Freshwater Lake | MSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDD |
| Ga0209296_13040713 | 3300027759 | Freshwater Lake | VRERGSKPMAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED |
| Ga0209296_13903371 | 3300027759 | Freshwater Lake | MAEPRYLMGDDYALNGVEGEEEEIGDVGLPDRMSEDED |
| Ga0209134_100919066 | 3300027764 | Freshwater Lake | MSEPRYLSGDEYALNGVEGEEEIGDAGLPDRMWEDED |
| Ga0209134_102020681 | 3300027764 | Freshwater Lake | MSEPRYLEGDEYALNGIEGEGEEEDTGDTGLPDRMWEDEE |
| Ga0209086_102641242 | 3300027770 | Freshwater Lake | MGEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED |
| Ga0209990_100171348 | 3300027816 | Freshwater Lake | MSEPMYLMGDDYALNGTEDDVDENDTGLPDRMWEDDE |
| Ga0209990_101749232 | 3300027816 | Freshwater Lake | MGEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE |
| Ga0247723_10061793 | 3300028025 | Deep Subsurface Sediment | MSEPMYLQGDEYALKGIEGDIDENDDSGLPDRMWEDDE |
| Ga0247723_100635211 | 3300028025 | Deep Subsurface Sediment | MPEPRYLEGDDYALNGVEGEEESDTGDTGEPDRMWEDEE |
| Ga0247723_10807405 | 3300028025 | Deep Subsurface Sediment | MSEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDEE |
| Ga0315907_100140586 | 3300031758 | Freshwater | MLGLWGAQLMSEPMYLMGDEYALKGTEDDVDENDDSGLPDRMWEDDE |
| Ga0315907_100247432 | 3300031758 | Freshwater | VSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEE |
| Ga0315907_1003383011 | 3300031758 | Freshwater | MKGKHMSEPMYLQGDDYALNGTEDDIDEDDTGLPDRMWEDEDA |
| Ga0315899_1000769612 | 3300031784 | Freshwater | MGLWGAQLMSEPMYLMGDDYALNGTEDDVDENDTGLPDRMWEDDE |
| Ga0315900_103162984 | 3300031787 | Freshwater | MPEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDED |
| Ga0315909_1002658311 | 3300031857 | Freshwater | MSEPMYLMGDEYALKGTEDDVDENDDSGLPDRMWEDDE |
| Ga0315909_107326281 | 3300031857 | Freshwater | MGEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDDE |
| Ga0315904_1000711419 | 3300031951 | Freshwater | MSEPMYLQGDDYALNGTEDDIDEDDTGLPDRMWEDEDA |
| Ga0315904_103369963 | 3300031951 | Freshwater | MSEPRYLEGDPYALTGVEGDDEEDDSGLPDRMWEDLD |
| Ga0334994_0340624_409_525 | 3300033993 | Freshwater | MSEPMYLMGDDYALKGDESDVDENDDSGLPDRMWEDDV |
| Ga0334995_0042962_136_252 | 3300034062 | Freshwater | MPEPRYLGGDDYALNGVEGEEEEAGDTGLPDRMWEDEE |
| Ga0335010_0181159_1193_1303 | 3300034092 | Freshwater | MSEPRYLEGDEYALNGIEGEGEEEDTGDTGLPDRMWE |
| ⦗Top⦘ |