| Basic Information | |
|---|---|
| Family ID | F103033 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MTRALLITNPAAARTDARAVTAIRDTLRRGGWSVDVLAT |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 92.08 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.020 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.772 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.634 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.505 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.36% β-sheet: 20.90% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF04357 | TamB | 77.23 |
| PF00781 | DAGK_cat | 0.99 |
| PF01103 | Omp85 | 0.99 |
| PF07244 | POTRA | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 77.23 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.02 % |
| Unclassified | root | N/A | 1.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10037761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1878 | Open in IMG/M |
| 3300002908|JGI25382J43887_10417753 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
| 3300002911|JGI25390J43892_10020368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1595 | Open in IMG/M |
| 3300004153|Ga0063455_100074228 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1286 | Open in IMG/M |
| 3300004480|Ga0062592_100049237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2273 | Open in IMG/M |
| 3300005406|Ga0070703_10488348 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300005536|Ga0070697_100806260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 831 | Open in IMG/M |
| 3300005540|Ga0066697_10352810 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 856 | Open in IMG/M |
| 3300005540|Ga0066697_10428157 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 765 | Open in IMG/M |
| 3300005554|Ga0066661_10792797 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 554 | Open in IMG/M |
| 3300005558|Ga0066698_11077723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300005843|Ga0068860_100714838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1012 | Open in IMG/M |
| 3300006041|Ga0075023_100316373 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 648 | Open in IMG/M |
| 3300006046|Ga0066652_100238712 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1585 | Open in IMG/M |
| 3300006046|Ga0066652_100354689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1321 | Open in IMG/M |
| 3300006755|Ga0079222_10385112 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 967 | Open in IMG/M |
| 3300006755|Ga0079222_11116223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 695 | Open in IMG/M |
| 3300006794|Ga0066658_10688236 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 564 | Open in IMG/M |
| 3300006797|Ga0066659_10163297 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1596 | Open in IMG/M |
| 3300006804|Ga0079221_11156798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 597 | Open in IMG/M |
| 3300006806|Ga0079220_10887669 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
| 3300006845|Ga0075421_100980824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 958 | Open in IMG/M |
| 3300006854|Ga0075425_101298768 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 825 | Open in IMG/M |
| 3300006918|Ga0079216_10728372 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 713 | Open in IMG/M |
| 3300006969|Ga0075419_10198093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1329 | Open in IMG/M |
| 3300007258|Ga0099793_10050641 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1830 | Open in IMG/M |
| 3300007258|Ga0099793_10172456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1031 | Open in IMG/M |
| 3300007265|Ga0099794_10503195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 638 | Open in IMG/M |
| 3300009012|Ga0066710_104064009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
| 3300009038|Ga0099829_10581593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 931 | Open in IMG/M |
| 3300009038|Ga0099829_10737103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
| 3300009089|Ga0099828_10125174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2250 | Open in IMG/M |
| 3300009137|Ga0066709_101566238 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 946 | Open in IMG/M |
| 3300009137|Ga0066709_103164998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
| 3300009156|Ga0111538_11057400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1027 | Open in IMG/M |
| 3300009162|Ga0075423_10809337 | Not Available | 991 | Open in IMG/M |
| 3300010303|Ga0134082_10003655 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5485 | Open in IMG/M |
| 3300010322|Ga0134084_10290095 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 604 | Open in IMG/M |
| 3300010336|Ga0134071_10445095 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
| 3300010337|Ga0134062_10287416 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 775 | Open in IMG/M |
| 3300010362|Ga0126377_12975145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 547 | Open in IMG/M |
| 3300012203|Ga0137399_11128567 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 660 | Open in IMG/M |
| 3300012203|Ga0137399_11296553 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
| 3300012205|Ga0137362_11019357 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
| 3300012207|Ga0137381_10097283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2492 | Open in IMG/M |
| 3300012207|Ga0137381_10738250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 855 | Open in IMG/M |
| 3300012210|Ga0137378_10176444 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1986 | Open in IMG/M |
| 3300012210|Ga0137378_10435041 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1216 | Open in IMG/M |
| 3300012211|Ga0137377_10947363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 792 | Open in IMG/M |
| 3300012211|Ga0137377_11581411 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
| 3300012212|Ga0150985_101804571 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1056 | Open in IMG/M |
| 3300012683|Ga0137398_10638542 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 738 | Open in IMG/M |
| 3300012685|Ga0137397_10009652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 6717 | Open in IMG/M |
| 3300012922|Ga0137394_11561465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 518 | Open in IMG/M |
| 3300012927|Ga0137416_10290446 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1351 | Open in IMG/M |
| 3300012944|Ga0137410_11659012 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
| 3300012972|Ga0134077_10480210 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 548 | Open in IMG/M |
| 3300012977|Ga0134087_10087693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1285 | Open in IMG/M |
| 3300012986|Ga0164304_10282218 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1129 | Open in IMG/M |
| 3300014154|Ga0134075_10248725 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
| 3300015241|Ga0137418_10981043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
| 3300015359|Ga0134085_10149802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 989 | Open in IMG/M |
| 3300015371|Ga0132258_11853009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1519 | Open in IMG/M |
| 3300017654|Ga0134069_1101008 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 940 | Open in IMG/M |
| 3300017654|Ga0134069_1346880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 533 | Open in IMG/M |
| 3300017659|Ga0134083_10255655 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 734 | Open in IMG/M |
| 3300017927|Ga0187824_10220381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 650 | Open in IMG/M |
| 3300017959|Ga0187779_10945918 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 595 | Open in IMG/M |
| 3300018032|Ga0187788_10208605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 760 | Open in IMG/M |
| 3300018056|Ga0184623_10417075 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
| 3300018061|Ga0184619_10553044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300018063|Ga0184637_10340518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 903 | Open in IMG/M |
| 3300018433|Ga0066667_10908706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 757 | Open in IMG/M |
| 3300018433|Ga0066667_12330249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300018468|Ga0066662_10178478 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1648 | Open in IMG/M |
| 3300019882|Ga0193713_1103581 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300024232|Ga0247664_1177860 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 504 | Open in IMG/M |
| 3300025910|Ga0207684_10133098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2134 | Open in IMG/M |
| 3300025910|Ga0207684_11261517 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 610 | Open in IMG/M |
| 3300025930|Ga0207701_11589880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300026306|Ga0209468_1187203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300026315|Ga0209686_1190314 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
| 3300026317|Ga0209154_1162225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 916 | Open in IMG/M |
| 3300026329|Ga0209375_1194578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 780 | Open in IMG/M |
| 3300026333|Ga0209158_1101104 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1099 | Open in IMG/M |
| 3300026333|Ga0209158_1218745 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 658 | Open in IMG/M |
| 3300026527|Ga0209059_1188003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 708 | Open in IMG/M |
| 3300026536|Ga0209058_1316516 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
| 3300026548|Ga0209161_10214583 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1047 | Open in IMG/M |
| 3300027882|Ga0209590_10997185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
| 3300028381|Ga0268264_10653546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1041 | Open in IMG/M |
| 3300028536|Ga0137415_11256130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
| 3300028828|Ga0307312_10613147 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 720 | Open in IMG/M |
| 3300031576|Ga0247727_10081964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3537 | Open in IMG/M |
| 3300031740|Ga0307468_101811942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
| 3300032180|Ga0307471_102601720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 641 | Open in IMG/M |
| 3300033417|Ga0214471_10146343 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1947 | Open in IMG/M |
| 3300033814|Ga0364930_0267624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
| 3300034162|Ga0373915_020537 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300034354|Ga0364943_0380901 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 543 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.95% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.99% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.99% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
| 3300034162 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.1 | Engineered | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_100377612 | 3300002561 | Grasslands Soil | MTRALLIANPAAARTDARAVTTVRDTLRRGGWTVEVLATA |
| JGI25382J43887_104177531 | 3300002908 | Grasslands Soil | MTRALLITNPAAARTDARAVTAIRDTLRRGGWSVDVLATT |
| JGI25390J43892_100203683 | 3300002911 | Grasslands Soil | VTRALLITNPFAARADARAVTAILRILGRGGWNVDLRTTTGPG |
| Ga0063455_1000742281 | 3300004153 | Soil | MTKALLITNPFAARAHEKSAAAIRDILEAGGWKVHVRSVAGP |
| Ga0062592_1000492372 | 3300004480 | Soil | MTRALLISNPFASRAHSNAVTVIRDILQGGGWAVDVHTTAGPG |
| Ga0070703_104883482 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRALLITNPFAARADARAVTAILKILGRGGWNVDLRTISGPG |
| Ga0070697_1008062601 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRALLIANPAAARTDARAVTAIRDTLRKGGWTVEVRATA |
| Ga0066697_103528101 | 3300005540 | Soil | MTRALLITNPAAARTDARAVTAIRDTLRRGGWSVDVLAT |
| Ga0066697_104281571 | 3300005540 | Soil | VTRALLIANPAAARTDARAVTTVRDTLRRGGWTVEVLAT |
| Ga0066661_107927972 | 3300005554 | Soil | VTRAVLITNPAAARHAARAVIGIRDTLRAGGWDVEVRATAEAG |
| Ga0066698_110777231 | 3300005558 | Soil | VTRALLIANPAAARTDARAVTTVRDTLRRGGWTVEVLATARSG |
| Ga0068860_1007148381 | 3300005843 | Switchgrass Rhizosphere | MTRALLITNPAAARTGARAVRAIRETLEGGGWTVDVQ |
| Ga0075023_1003163732 | 3300006041 | Watersheds | VTRALLITNPAAARTEEITVQAVAETLRRGGWSVE |
| Ga0066652_1002387121 | 3300006046 | Soil | VTRALLITNPFAARAHARAVTTIRDILQGGGWSVEVRSTA |
| Ga0066652_1003546891 | 3300006046 | Soil | MTRALLITNPFAARAHARAVTTIRDILQGGGWSVEVRSTA |
| Ga0079222_103851121 | 3300006755 | Agricultural Soil | MTRALLIANPAAARTDARAVTAIRDTLRGGGWTVEVRATAQA |
| Ga0079222_111162231 | 3300006755 | Agricultural Soil | VTKALLITNPAAARTDARAVTAVRETLRRGGWDVDVL |
| Ga0066658_106882361 | 3300006794 | Soil | MTRALLITNPAAARTDARAVTSIRDTLRGGGWAVEV |
| Ga0066659_101632971 | 3300006797 | Soil | VTRAVLITNPAAARHAARAVIGIRDTLRAGGWDVEVRATAEAGDV |
| Ga0079221_111567981 | 3300006804 | Agricultural Soil | VTRALLITNPAAARTDARAVTAIRETLRGGGWAVEVLATA |
| Ga0079220_108876692 | 3300006806 | Agricultural Soil | VTRALLIANPAVARTDARAVMAIRDMLRRGGWAVEVRATAQ |
| Ga0075421_1009808241 | 3300006845 | Populus Rhizosphere | VTRALLITNPAAARTDARAVTAIRETLRGGGWDVEVLAT |
| Ga0075425_1012987682 | 3300006854 | Populus Rhizosphere | MTRALLITNPAAARTDARAVTAVRETLRGGGWDVE |
| Ga0079216_107283722 | 3300006918 | Agricultural Soil | VTRALLIANPAAARTRQGAVKTVASTLRSTGWELEVLT |
| Ga0075419_101980931 | 3300006969 | Populus Rhizosphere | VTRALLITNPAAARNDARAVTAIRETLRGGGWDVEVLA |
| Ga0099793_100506412 | 3300007258 | Vadose Zone Soil | MTRALLITNPFAARADARAVTAILQILGRGGWNVDLRTITGPGD |
| Ga0099793_101724561 | 3300007258 | Vadose Zone Soil | MTRALLITNPFAARADARAVTAVLQILGRGGWNVDLRTITGPGD |
| Ga0099794_105031951 | 3300007265 | Vadose Zone Soil | MTRSLLITNPAAARTDARAVTAIRDTLRSGGWSVEVLATTQ |
| Ga0066710_1040640091 | 3300009012 | Grasslands Soil | VTRALLITNPAAARTDARAVTAIRDTLRGGGWSVEVLATAQ |
| Ga0099829_105815932 | 3300009038 | Vadose Zone Soil | MARALLIANPVAARTDARAVTTVRDTLRRGGWTVEVLATAR |
| Ga0099829_107371031 | 3300009038 | Vadose Zone Soil | VTRALLITNPAAARTDARAVTAIRETLRGGGWNVEVL |
| Ga0099828_101251741 | 3300009089 | Vadose Zone Soil | VTRALLITNPAAARTDARAVTAIRETLRGGGWDVE |
| Ga0066709_1015662382 | 3300009137 | Grasslands Soil | MPRALLITNPIAARMDVRSVSAVRETLRGAGWAIEVAATAG |
| Ga0066709_1031649982 | 3300009137 | Grasslands Soil | VTRALLITNPFAARADARAVTAILKILGRGGWNVDLRTITGPG |
| Ga0111538_110574001 | 3300009156 | Populus Rhizosphere | MTRALLISNPFASRAHSNAVTVIRDILQGGGWAVD |
| Ga0075423_108093372 | 3300009162 | Populus Rhizosphere | VTRALLIANPAAARTEARAVTTVRDALRRGGWAVEVLA |
| Ga0134082_100036551 | 3300010303 | Grasslands Soil | MTRALLIANPAAARTDARAVTAIRDTLRHGGWTVEVRATAQ |
| Ga0134084_102900951 | 3300010322 | Grasslands Soil | MTRALLITNPFAARADAKTVTAVLEVLSRGGWNVDLRTI |
| Ga0134071_104450952 | 3300010336 | Grasslands Soil | VTRALLIANPAAARTEARAVTTVRDALRRGGWAIEVLA |
| Ga0134062_102874161 | 3300010337 | Grasslands Soil | MTRALLIANPAAARTDAHAVTAIRDTLRRGGWTVEV |
| Ga0126377_129751451 | 3300010362 | Tropical Forest Soil | VIRALLITNPAAARTEDVAVRAVTETLERGGWKVE |
| Ga0137399_111285672 | 3300012203 | Vadose Zone Soil | MTRALVITNPFAARADARAVTAILEILGRGGWNVDLRTIKAPGD |
| Ga0137399_112965532 | 3300012203 | Vadose Zone Soil | MTRALLIANPAAARPDARAVTAVRDTLRRGGWTVEVLATA |
| Ga0137362_110193572 | 3300012205 | Vadose Zone Soil | MTRALLITNPFAARADARAVTAILKILGRGGWNVDLQTI |
| Ga0137381_100972832 | 3300012207 | Vadose Zone Soil | VTRALLITNPAAARTDARAVAAIRDTLRGGGWSVEVL |
| Ga0137381_107382502 | 3300012207 | Vadose Zone Soil | MTRALLITNPFAARADARAVTAILKILGRGGWNVDLQTITGPG |
| Ga0137378_101764441 | 3300012210 | Vadose Zone Soil | VARALLITNPAAARTDARAVAAIRETLNGGGWTVEVLATA |
| Ga0137378_104350411 | 3300012210 | Vadose Zone Soil | MTRALLITNPFAARADARAVTAILEILGRGGWNVDLKTISGPG |
| Ga0137377_109473632 | 3300012211 | Vadose Zone Soil | MARALLITNPFAARADARAVAAILRILGRGGWNVDLRT |
| Ga0137377_115814112 | 3300012211 | Vadose Zone Soil | VTRALLITNPFAARADARAVAAILRILGRGGWNVDLRT |
| Ga0150985_1018045711 | 3300012212 | Avena Fatua Rhizosphere | MTKALLITNPFAARAHEKSAAAIRDILEAGGWKVHVRSVAGPGDA |
| Ga0137398_106385421 | 3300012683 | Vadose Zone Soil | MTRALLITKPFAARAHARAVTAIRDNLQRGGWSVEVRSTA |
| Ga0137397_100096523 | 3300012685 | Vadose Zone Soil | VTRALLITNPAAARTDARAVRAIRETLRAGGWTVEVLATA |
| Ga0137394_115614652 | 3300012922 | Vadose Zone Soil | MTRALLITNPAAARTDLVAHKEIASTLRKGGWEV* |
| Ga0137416_102904461 | 3300012927 | Vadose Zone Soil | MARALLIANPAAARTEARAVTTVRDTLRRGGWTVEVLATAR |
| Ga0137410_116590122 | 3300012944 | Vadose Zone Soil | VTRALLITNPAAARTDARAVTAIRETLRGGGWDVEVLATA |
| Ga0134077_104802102 | 3300012972 | Grasslands Soil | MARALLIANPAAARTDARAVTAVRDTLRRGGWSVE |
| Ga0134087_100876931 | 3300012977 | Grasslands Soil | MTRALLIANPAAARTDARAVTTVRDTLRRGGWTVEVLAT |
| Ga0164304_102822182 | 3300012986 | Soil | MARALLIANPAAARTEARAVTTVRDTLRRGGWTVEVLA |
| Ga0134075_102487251 | 3300014154 | Grasslands Soil | MTRALLITNPFAARAHARAVTAIRDILQGGGWSVEVRST |
| Ga0137418_109810432 | 3300015241 | Vadose Zone Soil | MTRALLIANPAAARTDARAVTAVQDTLRRGGWTVEVLAT |
| Ga0134085_101498022 | 3300015359 | Grasslands Soil | VTRAVLITNPAAARHAARAVMGIRDTLRAGGWDVEVRAT |
| Ga0132258_118530092 | 3300015371 | Arabidopsis Rhizosphere | VTRALLIANPAAARTDARAVTAIRDTLRRGGWAVEVR |
| Ga0134069_11010081 | 3300017654 | Grasslands Soil | MTRALLITNPAAARTDARAVTAIRDTLRRGGWSVDVLATTQA |
| Ga0134069_13468802 | 3300017654 | Grasslands Soil | MTRALLITNPFAARAHARAVTTIRDILQGGGWSVEVRST |
| Ga0134083_102556552 | 3300017659 | Grasslands Soil | MTRALVITNPFAARADARAVTAILKILGRGGWNVDLRTIKAPG |
| Ga0187824_102203811 | 3300017927 | Freshwater Sediment | VTRVLLISNPVAARTDVRAIAAVRDVLQGGGWTVE |
| Ga0187779_109459181 | 3300017959 | Tropical Peatland | VTRALLITNPAAARTDARAVRGILDTLRSGGWTCDVQ |
| Ga0187788_102086052 | 3300018032 | Tropical Peatland | VITNPAAARTDARAVTAIRETLRSGGWTVEVRATAH |
| Ga0184623_104170751 | 3300018056 | Groundwater Sediment | VTRALLITNPFAARAHARAVTTIRDILQGGGWSVD |
| Ga0184619_105530441 | 3300018061 | Groundwater Sediment | VTRALLITNPAAARTGARAVRAIRETLEAGGWMVEIR |
| Ga0184637_103405182 | 3300018063 | Groundwater Sediment | VTRALLITNPVAARTEARAVAVVRDTLRAGGWTVDLLATNSP |
| Ga0066667_109087062 | 3300018433 | Grasslands Soil | VTRALLIANPAAARTDARAVTTVRDTLRRGGWTVEVLATA |
| Ga0066667_123302492 | 3300018433 | Grasslands Soil | MARALLITNPAAGRADARAVTVIRATLRPGGWSVDLLAP |
| Ga0066662_101784782 | 3300018468 | Grasslands Soil | MTRALLITNPAAARTDARAVTAIRDTLRRGGWSVDVLA |
| Ga0193713_11035811 | 3300019882 | Soil | MTRALLITNPFAARAHARAVTAIRDILQGGGWSVEVR |
| Ga0247664_11778601 | 3300024232 | Soil | VTRALLITNPAAARTEDVAVRAVAETLERGGWKVELAAT |
| Ga0207684_101330981 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRALLIANPAAARTDARAVTAIRDTLRRGGWTVEVRA |
| Ga0207684_112615171 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRALVIANPAAARTEARAVTTVRDALRRGGWAVEVLA |
| Ga0207701_115898801 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRVLLISNPFASRAHSNAVTVIRDILQGGGWAVDVHTTAGP |
| Ga0209468_11872031 | 3300026306 | Soil | MTRALLIANPAAARTDARAVTTVRDTLRRGGWTVEVLA |
| Ga0209686_11903141 | 3300026315 | Soil | MTRALLITNPVAARAHARAVTTISDVLRGGGWSLDI |
| Ga0209154_11622251 | 3300026317 | Soil | MTRALLIANPAAARTDARAVTAIRDTLRRGGWTVEVRAT |
| Ga0209375_11945782 | 3300026329 | Soil | VTRAVLITNPAAARHAARAVLAIRDTLRAGGWDVE |
| Ga0209158_11011041 | 3300026333 | Soil | MTRALLITNPFAARADARAVTAILKILGRGGWNVDLQTITGPGD |
| Ga0209158_12187452 | 3300026333 | Soil | VTRALLIANPAAARTEARAVTTVREALRRGGWAIEVLAT |
| Ga0209059_11880031 | 3300026527 | Soil | MTRALLIANPAAARTDARAVTAIRDTLRHGGWTVEVRA |
| Ga0209058_13165161 | 3300026536 | Soil | VTRALLITNPFAARADARAVTAILKILGRGGWSVDLRTITGP |
| Ga0209161_102145832 | 3300026548 | Soil | MTRALLITNPLAARAHARAVTTISDILRGGGWSVEVRSTTGP |
| Ga0209590_109971851 | 3300027882 | Vadose Zone Soil | MARALLIANPVAARTDARAVTTVRDTLRRGGWTVEVL |
| Ga0268264_106535462 | 3300028381 | Switchgrass Rhizosphere | MTRALLITNPAAARTGARAVRAIRETLEGGGWTVDVQATGK |
| Ga0137415_112561302 | 3300028536 | Vadose Zone Soil | MTRALLITNPAAARADARAVTAIRDTRRGGGWEVE |
| Ga0307312_106131471 | 3300028828 | Soil | VARALLITNPAAARTDLVAHKEIASTLRSGGWDIEV |
| Ga0247727_100819642 | 3300031576 | Biofilm | MTRALLITNPAAARLAARDVTVVRDILRAGGWALDLV |
| Ga0307405_107396341 | 3300031731 | Rhizosphere | VTRALLIANLAAARTAWAGVERVSQTLRSGGWDVQVIATQGPGHA |
| Ga0307468_1018119422 | 3300031740 | Hardwood Forest Soil | MTRALVITNPFAARGHVHAVTDILKVLGRGGWNVDL |
| Ga0307471_1026017202 | 3300032180 | Hardwood Forest Soil | VTRALLITNPAAARHDARALTAVRNTLRQGGWTVEVAA |
| Ga0214471_101463432 | 3300033417 | Soil | VTRALLITNPAAARTDARAVTAVREILRAGGWAVEVLA |
| Ga0364930_0267624_457_576 | 3300033814 | Sediment | MTRALLITNPAAARTEARAVTAIRETLRAGGWDVEVRATL |
| Ga0373915_020537_382_510 | 3300034162 | Sediment Slurry | MTRALLITNPFAARAHGNTATTIRDILQGGGWNVDVRSVAGPG |
| Ga0364943_0380901_2_133 | 3300034354 | Sediment | MTRALLISNPFAARAHSGAVTAIRDILVRGGWKVDVHTTTGPGD |
| ⦗Top⦘ |