| Basic Information | |
|---|---|
| Family ID | F103012 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 43 residues |
| Representative Sequence | METILISLCIAISGGVIGYIFGYRHGSGDMDRTYKDVYNIKEY |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 70.30 % |
| % of genes near scaffold ends (potentially truncated) | 21.78 % |
| % of genes from short scaffolds (< 2000 bps) | 73.27 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.446 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine (17.822 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.188 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.059 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.70% β-sheet: 0.00% Coil/Unstructured: 49.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00004 | AAA | 5.94 |
| PF12708 | Pectate_lyase_3 | 0.99 |
| PF00462 | Glutaredoxin | 0.99 |
| PF06568 | DUF1127 | 0.99 |
| PF02739 | 5_3_exonuc_N | 0.99 |
| PF00438 | S-AdoMet_synt_N | 0.99 |
| PF03783 | CsgG | 0.99 |
| PF13455 | MUG113 | 0.99 |
| PF02773 | S-AdoMet_synt_C | 0.99 |
| PF04304 | DUF454 | 0.99 |
| PF01653 | DNA_ligase_aden | 0.99 |
| PF00149 | Metallophos | 0.99 |
| PF10431 | ClpB_D2-small | 0.99 |
| PF03215 | Rad17 | 0.99 |
| PF06941 | NT5C | 0.99 |
| PF03796 | DnaB_C | 0.99 |
| PF13186 | SPASM | 0.99 |
| PF01192 | RNA_pol_Rpb6 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 1.98 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.99 |
| COG0272 | NAD-dependent DNA ligase | Replication, recombination and repair [L] | 0.99 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.99 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.99 |
| COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 0.99 |
| COG2832 | Uncharacterized membrane protein YbaN, DUF454 family | Function unknown [S] | 0.99 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.99 |
| COG5457 | Uncharacterized conserved protein YjiS, DUF1127 family | Function unknown [S] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.45 % |
| All Organisms | root | All Organisms | 44.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 17.82% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 14.85% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 12.87% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.88% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.93% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.97% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.98% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.98% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.98% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.98% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.99% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.99% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.99% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.99% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.99% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.99% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.99% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.99% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300002230 | Marine microbial communities from the Baltic Sea - M1t2 FKB2 (103N) | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003410 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300005735 | Seawater microbial communities from Vineyard Sound, MA, USA - control T0 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009142 | Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020187 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023701 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 47R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025502 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025821 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026421 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 20R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_101614191 | 3300000116 | Marine | METILISLCIAISGGVIGYIFGYRHGSGDIDRIYKDVYDIKET* |
| BBAY92_101330701 | 3300000947 | Macroalgal Surface | METILISLCIAISGGLIGYIFGYRHGSGDMDRAYKDVYNIGDH* |
| JGI20152J14361_100899782 | 3300001344 | Pelagic Marine | METILISLCIAISGGVIGYIFGYRHGSGDIDRIYKDVYNIKET* |
| M1t2FKB2103N_12532144 | 3300002230 | Marine | METILIALCIAICGGLIGYLFGYRNGSNDIEQVYKDVYDIKDY* |
| JGI26079J46598_10022069 | 3300003216 | Marine | METILIALCIAICGGLIGYLFGYRTGSNDIEQVYKDVYDIKDY* |
| JGI26079J46598_10598562 | 3300003216 | Marine | METILISLCIAISGGVIGYIFGYRHGSGDVDRIYKDVYNIGDH* |
| JGI26080J50196_10749602 | 3300003345 | Marine | MFETISISLCIAISGGVIGYIFGYRHGSGDIDRAYKDIYNIKDHS* |
| JGI26081J50195_10111306 | 3300003346 | Marine | METILISLCIAICGGVIGYIFGYRHGSGDVDRIYKDVYDIKEV* |
| JGI26081J50195_10397175 | 3300003346 | Marine | METILISLCIAVCGGVIGYIFGYRHGSSDMDRNYKEAYNIREV* |
| JGI26081J50195_10955311 | 3300003346 | Marine | MEVIMISLCIAICGVIIGYIVGYNHGGKDMDRAYKDAYNIKDYR* |
| JGI26086J50260_10275706 | 3300003410 | Marine | METILISLXIAISGGVIGYIFGYRHGSGDVDRIYKDVYNIGDH* |
| JGI26260J51721_10018776 | 3300003580 | Marine | METILISLCIAICGGMIGFILGYRSGSGDMDRTYKDVYNITEN* |
| JGI26082J51739_100701375 | 3300003617 | Marine | METILISLCIAVXGGVIGYIFGYRHGSSDMDRNYKEAYNIREV* |
| JGI26273J51734_1000753516 | 3300003620 | Marine | METILISXXIAICGGLIGFIFGYRXGSSDMDRNYREAYNIKDH* |
| Ga0055584_1009549732 | 3300004097 | Pelagic Marine | METILISLCIAVSGGVIGYIFGYRHGSSDMDRNYKDVYNIQEV* |
| Ga0066605_101231205 | 3300004279 | Marine | MKHLKWMMEPNMETILISLCIAICGGIIGFIFGYRSGSSDMDRNYKEAYNIKDY* |
| Ga0076923_1070512 | 3300005735 | Marine | METILISLCIAISGGVIGYIFGYRHGSGDMDRTYKDVYDIKEY* |
| Ga0078893_1064835913 | 3300005837 | Marine Surface Water | METILISLCIAISGGVIGYIFGYRHGSGDMDRTYKDVYNIKEY* |
| Ga0075108_100732626 | 3300005913 | Saline Lake | MEIILTSVCIAICGAVIGWIVGYNQGSKDIEKIYKDVYHIKGY* |
| Ga0070742_100403511 | 3300005942 | Estuarine | ETILISLCIAICGGVIGYIFGYRHGSGDVDRIYKDVYDIKEV* |
| Ga0098054_100871110 | 3300006789 | Marine | METILISLCIAISGGVIGYIFGYRHGSGDMDRTYKDVYDIKQY* |
| Ga0098050_11307543 | 3300006925 | Marine | METILISLCIAISGGVIGYIFGYRHGSSDMDRTYKDVYDIKQY* |
| Ga0075468_100022507 | 3300007229 | Aqueous | METILISLCIAICGGIIGFIFGYRSGSSDIEQVYKDVYEHCIKDY* |
| Ga0075469_100033665 | 3300007231 | Aqueous | METILIALCIAICGGVIGYIFGYRSGSSDIEQVYKDVYEHCIKDY* |
| Ga0099847_10086718 | 3300007540 | Aqueous | MEVILTSLCIAISGGIIGWIVGYNQGSKDIDTIYKDVYDIKEV* |
| Ga0102960_11837894 | 3300009000 | Pond Water | METILISLCIAICGGVIGYIFGYRHGSGDVDRIYK |
| Ga0115566_1000096137 | 3300009071 | Pelagic Marine | MEPNMENILIALCIAISGGVIGYIFGYRHGSSDMDRNYKEAYNIKET* |
| Ga0115566_101411064 | 3300009071 | Pelagic Marine | MEVIMISLCIAICGVIIGYIVGYNHGSKDMDRAYKDAYNIKDYR* |
| Ga0115566_103200485 | 3300009071 | Pelagic Marine | ENILIALCIAISGGVIGYIFGYRHGSGDMDRTYKDVYNIKEY* |
| Ga0115566_104457484 | 3300009071 | Pelagic Marine | MEHNMETILISLCIAISGGVIGYIFGYRHGSGDIDRIYKDVYNIKET* |
| Ga0115566_106542483 | 3300009071 | Pelagic Marine | MEPNMETILISLCIAISGGVIGYIFGYRHGSNDMDRNYKEAYNIKEF* |
| Ga0115550_12079713 | 3300009076 | Pelagic Marine | MEPNMENILIALCIAISGGVIGYIFGYRHGSGDMDRTYKDVYNIKEY* |
| Ga0102885_11663453 | 3300009142 | Estuarine | METILISLCIAICGGVIGYIFGYRHGSGDVDRIYKDVY |
| Ga0115547_10905775 | 3300009426 | Pelagic Marine | MEPNMETILISLCIAISGGVIGYIFGYRHGSGDIDRIYK |
| Ga0115005_102248412 | 3300009432 | Marine | MEIILSALCIAISGVIIGWIFGYNQGSEDIGNIYKDVYDIKEL* |
| Ga0115556_11564634 | 3300009437 | Pelagic Marine | MEPNMETILISLCIAISGGVIGYIFGYRHGSGDIDRIYKDVYNIKET* |
| Ga0115561_11730826 | 3300009440 | Pelagic Marine | MMEPNMENILIALCIAVSGGVIGYIFGYRHGSSDMDRNYKEAYNIKEF* |
| Ga0115571_13467122 | 3300009495 | Pelagic Marine | MEPNMETILISLCIAISGGVIGYIFGYRHGSGDMDRNYREAYNIKDH* |
| Ga0115570_100474866 | 3300009496 | Pelagic Marine | METILISLCIAISGGVIGYIFGYRHGSGDMDRNYREAYNIKDH* |
| Ga0115572_101578213 | 3300009507 | Pelagic Marine | MEVILTSLCIAICGGIIGWIVGYNQGSKDIDAIYKDVYNIKEV* |
| Ga0115572_104657202 | 3300009507 | Pelagic Marine | MENILIALCIAISGGVIGYIFGYRHGSKDIDRIYKDVYNIKEF* |
| Ga0129348_13280281 | 3300010296 | Freshwater To Marine Saline Gradient | ISLCIAISGGVIGYIFGYRHGSGDMDRTYKDVYDIKEY* |
| Ga0129352_105595574 | 3300012528 | Aqueous | KWITEHNMETILISLCIAISGGVIGYIFGYRHGSGDMDRTYKDVYDIKEY* |
| Ga0129327_1000379714 | 3300013010 | Freshwater To Marine Saline Gradient | METILISLCIAVSGGVIGYIFGYRHGSSDMDRNYKDVYNIREV* |
| Ga0181391_10281112 | 3300017713 | Seawater | METILISLCIAICGGTIGFIFGYRSGSSDMDRNYREAYNIKEV |
| Ga0181401_10102563 | 3300017727 | Seawater | METILISLCIAICGGTIGFIFGYRSGSSDMDRNYKEAYNIKEV |
| Ga0181399_10463881 | 3300017742 | Seawater | METILISLCIAICGGTIGFIFGYRSGSSDMDRNYREAYNIKDY |
| Ga0181399_10583824 | 3300017742 | Seawater | METILISLCIAICGGTIGFIFGYRSGSSDMDRNYREAYNIK |
| Ga0181392_10364071 | 3300017749 | Seawater | METILISLCIAICGGTIGFIFGYRSGSSDMDRNYREAYNIKDH |
| Ga0187219_10373854 | 3300017751 | Seawater | METILISLCIAICGGIIGYIFGYRHGSGDMDRTYKDVYNITEN |
| Ga0181400_10946131 | 3300017752 | Seawater | EPRMETILISLCIAICGGTIGFIFGYRSGSSDMDRNYKEAYNIKEV |
| Ga0181407_10665751 | 3300017753 | Seawater | ILISLCIAICGGLIGFIFGYRSGSSDMDRNYREAYNIKDH |
| Ga0187217_10261137 | 3300017770 | Seawater | METILISLCIAICGGLIGFIFGYRSGSSDMDRNYREA |
| Ga0187217_10503541 | 3300017770 | Seawater | RYDMETILISLCIAICGGLIGFIFGYRSGSSDMDRNYREA |
| Ga0181380_10347271 | 3300017782 | Seawater | METILISLCIAICGGLIGFIFGYRSGSSDMDRNYRAAYNIKDH |
| Ga0181424_101762932 | 3300017786 | Seawater | MEPRMETILISLCIAICGGTIGFIFGYRSGSSDMDRNYKEAYNIKEV |
| Ga0181607_1000129030 | 3300017950 | Salt Marsh | MEVIMISLCIAICGVIIGYIVGYNHGGKDMDRAYKDAYNIKDYR |
| Ga0206125_101072455 | 3300020165 | Seawater | METILIALCIAISGGVIGYIFGYRHGSGDMDRTYKDVYNIKEF |
| Ga0206125_101288761 | 3300020165 | Seawater | MEVIMISLCIAICGVIIGYIVGYNHGSKDMDRAYKDAY |
| Ga0206125_101295013 | 3300020165 | Seawater | MENILIALCIAVSGGVIGYIFGYRHGSSDMDRNYKDVYNIREV |
| Ga0206128_10062926 | 3300020166 | Seawater | MEVIMISLCIAICGVIIGYIVGYNHGSKDMDRAYKDAYNIKDYR |
| Ga0206128_10081091 | 3300020166 | Seawater | MELNMENILIALCIAVSGGVIGYIFGYRHGSSDMDRNYKDVYNIREV |
| Ga0206128_12932281 | 3300020166 | Seawater | METILISLCIAVSGGVIGYIFGYRHGSSDMDRNYKDVYNIREV |
| Ga0206124_101203963 | 3300020175 | Seawater | MEPNMETILIALCIAISGGVIGYIFGYRHGSGDMDRTYKDVYNIKEF |
| Ga0206129_100747985 | 3300020182 | Seawater | MEPNMENILIALCIAISGGVIGYIFGYRHGSSDMDRNYKEAYNIKET |
| Ga0206129_102107984 | 3300020182 | Seawater | METILISLCIAVCGGVIGYIFGYRHGSSDMDRNYKEAYNIREV |
| Ga0206131_101580612 | 3300020185 | Seawater | METILISLCIAISGGVIGYIFGYRHGSGDIDRIYKDVYNIKET |
| Ga0206130_103643353 | 3300020187 | Seawater | METILISLCIAVSGGVIGYIFGYRHGSSDMDRNYKD |
| Ga0211576_101705342 | 3300020438 | Marine | METILISLCIAICGGLIGFIFGYRSGSSDMDRNYREAYNIKDH |
| Ga0206677_100567981 | 3300021085 | Seawater | METILISLCIAVCGGVIGYIFGYRHGSSDMDRNYKEAYNI |
| Ga0213867_10105997 | 3300021335 | Seawater | METILISLCIAISGGVIGYIFGYRHGSGDMDRTYKDVYNIKEY |
| Ga0206123_100404218 | 3300021365 | Seawater | MELNMENILIALCIAVSGGVIGYIFGYRHGSSDMD |
| Ga0206123_103527603 | 3300021365 | Seawater | MELNMENILIALCIAVSGGVIGYIFGYRHGSSDMDRNYKDVYNIQEV |
| Ga0213863_100396757 | 3300021371 | Seawater | METILISLCIAISGGVIGYIFGYRHGSGDMDRTYKDVYDIKEY |
| Ga0222717_105629891 | 3300021957 | Estuarine Water | MEIILTSLCIAISGGIIGWIVGYNQGSKDIDTIYKDVYDIKEI |
| Ga0196895_10120804 | 3300022067 | Aqueous | METILISLCIAISGGVIGYIFGYRHGSGDIDRIYKDVYDIKET |
| (restricted) Ga0233432_1000197133 | 3300023109 | Seawater | METILISLCIAICGGLIGFIFGYRTGSSDMDRNYREAYNIKDH |
| (restricted) Ga0233432_100820452 | 3300023109 | Seawater | METILISLCIAISGGVIGYIFGYRHGSGDVDRIYKDVYNIGDH |
| Ga0228685_10758023 | 3300023701 | Seawater | METILISLCIAICGGLIGFIFGYRSGSSDMDRNYREAYNI |
| Ga0244775_100428445 | 3300024346 | Estuarine | METILISLCIAICGGVIGYIFGYRHGSGDVDRIYKDVYDIKEV |
| Ga0244775_107768154 | 3300024346 | Estuarine | MFETISISLCIAISGGVIGYIFGYRHGSGDIDRAYKDIYNIKDHS |
| Ga0208667_10512932 | 3300025070 | Marine | METILISLCIAISGGVIGYIFGYRHGSGDMDRTYKDVYDIKQY |
| Ga0208792_10037989 | 3300025085 | Marine | METILISLCIAVCGGLIGFIFGYRSGSSDMDRNYREAYNIKDH |
| Ga0208434_10397643 | 3300025098 | Marine | METILISLCIAISGGVIGYIFGYRHGSSDMDRTYKDVYDIKQY |
| Ga0209557_100239610 | 3300025483 | Marine | METILIALCIAICGGLIGYLFGYRTGSNDIEQVYKDVYDIKDY |
| Ga0209557_100240225 | 3300025483 | Marine | METILISLCIAICGGMIGFILGYRSGSGDMDRTYKDVYNITEN |
| Ga0208903_10281758 | 3300025502 | Saline Lake | MEIILTSVCIAICGAVIGWIVGYNQGSKDIEKIYKDVYHIKGY |
| Ga0208660_100379010 | 3300025570 | Aqueous | METILIALCIAICGGVIGYIFGYRSGSSDIEQVYKDVYEHCIKDY |
| Ga0209716_10314697 | 3300025626 | Pelagic Marine | METILISLCIAICGGTIGFIFGYRTGSSDMDRNYKEAYNIKDY |
| Ga0209194_10547913 | 3300025632 | Pelagic Marine | MENILIALCIAISGGVIGYIFGYRHGSGDMDRTYKDVYNIKEY |
| Ga0208643_10782794 | 3300025645 | Aqueous | MEIILTSLCIAISGGIIGWIVGYNQGSKDIDTIYKDVYDIKEV |
| Ga0209771_10596905 | 3300025701 | Marine | LCIAICGGVIGYIFGYRHGSGDVDRIYKDVYDIKEV |
| Ga0209602_11352905 | 3300025704 | Pelagic Marine | METILISLCIAISGGVIGYIFGYRHGSGDMDRNYREAYNIKDH |
| Ga0209137_10577487 | 3300025767 | Marine | ETILISLCIAVCGGVIGYIFGYRHGSSDMDRNYKEAYNIREV |
| Ga0209600_10848414 | 3300025821 | Pelagic Marine | MMEHNMETILISLCIAISGGVIGYIFGYRHGSGDIDRIYKDVYNIKET |
| Ga0209308_100648285 | 3300025869 | Pelagic Marine | KWMMEPNMENILIALCIAISGGVIGYIFGYRHGSSDMDRNYKEAYNIKET |
| Ga0209666_13044583 | 3300025870 | Marine | MEPNMETILISLCIAICGGIIGFIFGYRSGSSDMDRNYKEAYNIKDY |
| Ga0209631_101901602 | 3300025890 | Pelagic Marine | MKHLKWMMEPNMENILIALCIAISGGVIGYIFGYRHGSSDMDRNYKEAYNIKET |
| Ga0209631_104449263 | 3300025890 | Pelagic Marine | METILISLCIAISGGVIGYIFGYRHGSNDMDRNYKEAYNIKEF |
| Ga0247569_10984391 | 3300026421 | Seawater | METILISLCIAICGGLIGFIFGYRSGSSDMDRNYR |
| Ga0209712_101547912 | 3300027849 | Marine | MEIILTSLCIAISGAIIGWIVGYNQGSKDIGNIYKDVYDIKELGWTSL |
| ⦗Top⦘ |