| Basic Information | |
|---|---|
| Family ID | F102983 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQPQTTH |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 56.44 % |
| % of genes near scaffold ends (potentially truncated) | 20.79 % |
| % of genes from short scaffolds (< 2000 bps) | 89.11 % |
| Associated GOLD sequencing projects | 69 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.040 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (29.703 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.356 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.347 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 66.67% β-sheet: 0.00% Coil/Unstructured: 33.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF05685 | Uma2 | 14.85 |
| PF02397 | Bac_transf | 0.99 |
| PF00072 | Response_reg | 0.99 |
| PF07617 | DUF1579 | 0.99 |
| PF02452 | PemK_toxin | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 14.85 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.04 % |
| Unclassified | root | N/A | 3.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1023583 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1072 | Open in IMG/M |
| 3300002557|JGI25381J37097_1035820 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 840 | Open in IMG/M |
| 3300002560|JGI25383J37093_10040597 | Not Available | 1533 | Open in IMG/M |
| 3300002561|JGI25384J37096_10152143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 738 | Open in IMG/M |
| 3300002908|JGI25382J43887_10044714 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2407 | Open in IMG/M |
| 3300002909|JGI25388J43891_1081288 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300005166|Ga0066674_10512735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
| 3300005172|Ga0066683_10064921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2175 | Open in IMG/M |
| 3300005172|Ga0066683_10462837 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005172|Ga0066683_10510225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 734 | Open in IMG/M |
| 3300005172|Ga0066683_10682361 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005181|Ga0066678_10261467 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300005181|Ga0066678_10446656 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300005446|Ga0066686_10256952 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300005446|Ga0066686_10272761 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300005450|Ga0066682_10148503 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1491 | Open in IMG/M |
| 3300005467|Ga0070706_101570867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 600 | Open in IMG/M |
| 3300005471|Ga0070698_101437982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 640 | Open in IMG/M |
| 3300005518|Ga0070699_100244448 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300005553|Ga0066695_10048388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2520 | Open in IMG/M |
| 3300005557|Ga0066704_10493159 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300005559|Ga0066700_10638533 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005574|Ga0066694_10329208 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 726 | Open in IMG/M |
| 3300005586|Ga0066691_10499988 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300006034|Ga0066656_10370823 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300006034|Ga0066656_10470306 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
| 3300006791|Ga0066653_10447186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 659 | Open in IMG/M |
| 3300006791|Ga0066653_10598596 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
| 3300006796|Ga0066665_11540650 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
| 3300006797|Ga0066659_10607394 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300006852|Ga0075433_10330520 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1348 | Open in IMG/M |
| 3300006871|Ga0075434_100004476 | All Organisms → cellular organisms → Bacteria | 12610 | Open in IMG/M |
| 3300009012|Ga0066710_102768045 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 695 | Open in IMG/M |
| 3300009012|Ga0066710_103748589 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
| 3300009090|Ga0099827_10151046 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1901 | Open in IMG/M |
| 3300009090|Ga0099827_10243350 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300009137|Ga0066709_103488749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 571 | Open in IMG/M |
| 3300009147|Ga0114129_12730018 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 588 | Open in IMG/M |
| 3300010304|Ga0134088_10253859 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 846 | Open in IMG/M |
| 3300010304|Ga0134088_10576554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 558 | Open in IMG/M |
| 3300010320|Ga0134109_10413275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 542 | Open in IMG/M |
| 3300010336|Ga0134071_10097749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1391 | Open in IMG/M |
| 3300010336|Ga0134071_10187427 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300010336|Ga0134071_10254456 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010337|Ga0134062_10146137 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300012198|Ga0137364_10532834 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 883 | Open in IMG/M |
| 3300012198|Ga0137364_10934092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 657 | Open in IMG/M |
| 3300012199|Ga0137383_10912482 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300012200|Ga0137382_10864809 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012201|Ga0137365_10471845 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 923 | Open in IMG/M |
| 3300012203|Ga0137399_10921465 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 736 | Open in IMG/M |
| 3300012206|Ga0137380_10648432 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300012206|Ga0137380_11551407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
| 3300012209|Ga0137379_11428194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 595 | Open in IMG/M |
| 3300012210|Ga0137378_10052173 | All Organisms → cellular organisms → Bacteria | 3684 | Open in IMG/M |
| 3300012210|Ga0137378_10749332 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 888 | Open in IMG/M |
| 3300012211|Ga0137377_10493829 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300012285|Ga0137370_10110069 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1559 | Open in IMG/M |
| 3300012349|Ga0137387_10934727 | Not Available | 625 | Open in IMG/M |
| 3300012349|Ga0137387_10983847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 606 | Open in IMG/M |
| 3300012350|Ga0137372_10060999 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3284 | Open in IMG/M |
| 3300012351|Ga0137386_10062728 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2584 | Open in IMG/M |
| 3300012351|Ga0137386_10782922 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 685 | Open in IMG/M |
| 3300012351|Ga0137386_10951415 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 613 | Open in IMG/M |
| 3300012354|Ga0137366_11123132 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012357|Ga0137384_10666497 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300012359|Ga0137385_10839313 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012379|Ga0134058_1151078 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 574 | Open in IMG/M |
| 3300012398|Ga0134051_1028326 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 963 | Open in IMG/M |
| 3300012399|Ga0134061_1290196 | Not Available | 513 | Open in IMG/M |
| 3300012400|Ga0134048_1145125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 668 | Open in IMG/M |
| 3300012403|Ga0134049_1192475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1173 | Open in IMG/M |
| 3300012410|Ga0134060_1376184 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012925|Ga0137419_10600723 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 884 | Open in IMG/M |
| 3300012930|Ga0137407_10376815 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1311 | Open in IMG/M |
| 3300012972|Ga0134077_10359111 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300014154|Ga0134075_10027418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2300 | Open in IMG/M |
| 3300017654|Ga0134069_1212536 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300017657|Ga0134074_1219811 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300017659|Ga0134083_10233452 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 766 | Open in IMG/M |
| 3300018433|Ga0066667_10054327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2438 | Open in IMG/M |
| 3300018433|Ga0066667_11370546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 620 | Open in IMG/M |
| 3300026277|Ga0209350_1039570 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300026295|Ga0209234_1042365 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300026295|Ga0209234_1071834 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1316 | Open in IMG/M |
| 3300026296|Ga0209235_1149504 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 931 | Open in IMG/M |
| 3300026301|Ga0209238_1210305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 571 | Open in IMG/M |
| 3300026310|Ga0209239_1034640 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2373 | Open in IMG/M |
| 3300026316|Ga0209155_1270998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300026326|Ga0209801_1224846 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300026327|Ga0209266_1027301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3069 | Open in IMG/M |
| 3300026327|Ga0209266_1083105 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1449 | Open in IMG/M |
| 3300026329|Ga0209375_1056227 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1932 | Open in IMG/M |
| 3300026332|Ga0209803_1164623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 846 | Open in IMG/M |
| 3300026343|Ga0209159_1165695 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 821 | Open in IMG/M |
| 3300026528|Ga0209378_1186474 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300026532|Ga0209160_1092803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1552 | Open in IMG/M |
| 3300026537|Ga0209157_1169967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 958 | Open in IMG/M |
| 3300027882|Ga0209590_10328202 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 985 | Open in IMG/M |
| 3300028536|Ga0137415_10875906 | Not Available | 708 | Open in IMG/M |
| 3300031720|Ga0307469_10180984 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1621 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 29.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 17.82% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 16.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10235833 | 3300002557 | Grasslands Soil | MDVLIHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARGESTQPQTTH* |
| JGI25381J37097_10358203 | 3300002557 | Grasslands Soil | MDVLIHWIPTLAAALVLTIAGFVLDWRIRAEQRAQVARGESTQPQTTH* |
| JGI25383J37093_100405972 | 3300002560 | Grasslands Soil | MDVLLHWIPTLAAALVLAIAGFVLDWRIRAERRARAARGESTQPQTTH* |
| JGI25384J37096_101521431 | 3300002561 | Grasslands Soil | MDVLLHWIPTLAAALVLAIAGFVLDWRIRAERRARAARGESTQPQTTH |
| JGI25382J43887_100447141 | 3300002908 | Grasslands Soil | MDVLIHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARGESTQPHTTH* |
| JGI25388J43891_10812881 | 3300002909 | Grasslands Soil | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQPQTTH* |
| Ga0066674_105127352 | 3300005166 | Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRAERRAQAARGEST |
| Ga0066683_100649212 | 3300005172 | Soil | MDVLLHWIPTFAAALVLAIAGFVLDWRSRAERRARAARGESTQPQTTH* |
| Ga0066683_104628372 | 3300005172 | Soil | MDLLLHWIPTLAAALVLTVAAFVLDWRIRAERRAQAARGESTQPQTTQ* |
| Ga0066683_105102252 | 3300005172 | Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRDERRAQAARGESTQPQTTH* |
| Ga0066683_106823612 | 3300005172 | Soil | MDLLLHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARDESTQPQTTH* |
| Ga0066678_102614672 | 3300005181 | Soil | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQPQATH* |
| Ga0066678_104466562 | 3300005181 | Soil | MDLLLHWIPTLAAALVLTVAAFVLDWRIRAERRAQVARGESTQPQTTQ* |
| Ga0066686_102569523 | 3300005446 | Soil | MMPMSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQVARGESTQPQTTH* |
| Ga0066686_102727612 | 3300005446 | Soil | LLRSPPSGAIMDLLLHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARDESTQPQTTH* |
| Ga0066682_101485033 | 3300005450 | Soil | MSFLVHWIPALAGGFVLVIASWVLETRIRAERRAQAARGESTQPQTTH* |
| Ga0070706_1015708671 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRARATHGDSTQPQTTR* |
| Ga0070698_1014379821 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MSFLVHWIPALAGGFVLLIASWVLEMRIRTERRARATRGESTQPQTTR* |
| Ga0070699_1002444482 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MMPMSFLVHWIPALAGGFVLLIASWVLETRIRAERRARATRGESTQPQTTH* |
| Ga0066695_100483882 | 3300005553 | Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRAERRAQAARGESTRPQTTH* |
| Ga0066704_104931592 | 3300005557 | Soil | MDLLLHWIPTLAAALVVTVAAFVLDWRIRAERRAQVARDESTQPQTTH* |
| Ga0066700_106385331 | 3300005559 | Soil | MDLLLHWIPTLAAALVLTVAAFVLDWRIRAERRAQVARGESTQPQTTH* |
| Ga0066694_103292081 | 3300005574 | Soil | MDVLLHWIPTLAAALVLAIAGFVLDWRSRAERRARAARGESTQPQTTH* |
| Ga0066691_104999882 | 3300005586 | Soil | MDLLLHWIPTLAAALVVTVAAFVLDWRIRAERRAQVARGESTQPQTTQ* |
| Ga0066656_103708232 | 3300006034 | Soil | HWIPTLAAALVLTIAGFVLDWRIRAERRAQVARGESTQPQTTH* |
| Ga0066656_104703063 | 3300006034 | Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRAECRAQAARGESTRPQTTH* |
| Ga0066653_104471862 | 3300006791 | Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRAERRAQAARGESTQPQTTH* |
| Ga0066653_105985962 | 3300006791 | Soil | LLRSPPSGAIMDLLLHWIPTLAAALVVTVAAFVLDWRIRAERRAQVARDESTQPQTTH* |
| Ga0066665_115406501 | 3300006796 | Soil | MDVLLHWIPTLAAALVLAIAGFVLDWRIRAERRARAARGESTQPLTTH* |
| Ga0066659_106073941 | 3300006797 | Soil | LLRSPPSGAIMDLLLHWIPTLAAALVLTVAAFVLDWRIRAERRAQVARGESTQPQTTQ* |
| Ga0075433_103305201 | 3300006852 | Populus Rhizosphere | MMCMSFLVHWIPALAAGFVLLIAGWVLETRIRAERRAQAGRGKSTQPQTTP* |
| Ga0075434_10000447611 | 3300006871 | Populus Rhizosphere | MSFLVHWIPALAAGFVLLIAGWVLETRIRAERRAQAGRGKSTQPQTTP* |
| Ga0066710_1027680453 | 3300009012 | Grasslands Soil | MDVLIHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARGESTQPQTTH |
| Ga0066710_1037485891 | 3300009012 | Grasslands Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRDERRAQAARGESTQPQTTH |
| Ga0099827_101510462 | 3300009090 | Vadose Zone Soil | MPVLIHWIPTLAAALVLTIAGFVLDWRIRAERRVRVARGESTQPQTTH* |
| Ga0099827_102433503 | 3300009090 | Vadose Zone Soil | MSFLVHWIPALAGGFVLLVASWVLETRIRAERRAQLARGESTQPQATP* |
| Ga0066709_1034887491 | 3300009137 | Grasslands Soil | MSFLVHWIPALAGGFVLVIASWVLETRIRDERRAQAARGESTQPQTTH* |
| Ga0114129_127300181 | 3300009147 | Populus Rhizosphere | MSFLVHWIPALAAGFVLLIAGWVLETRIRAERRAQAGRGKST |
| Ga0134088_102538592 | 3300010304 | Grasslands Soil | MMPMSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQPQTTH* |
| Ga0134088_105765542 | 3300010304 | Grasslands Soil | MDLLLHWIPTLAAALVLTIAGFVLDWRIRAERPAQVARDESTQPQTTH* |
| Ga0134109_104132751 | 3300010320 | Grasslands Soil | MDLLLHWIPMLGAALVLTIAGFVLDWRIRAERRAQVARGESTQPQTTH* |
| Ga0134071_100977494 | 3300010336 | Grasslands Soil | MDILIHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARGESTQPQTTH* |
| Ga0134071_101874272 | 3300010336 | Grasslands Soil | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQVARGESTQPQTTH* |
| Ga0134071_102544562 | 3300010336 | Grasslands Soil | MDLLLHWIPTLAAALVLAVVGFVLDWRIRAERRAQVARGESTQP* |
| Ga0134062_101461372 | 3300010337 | Grasslands Soil | KPRSKDDAMSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQPQTTH* |
| Ga0137364_105328342 | 3300012198 | Vadose Zone Soil | MDVLLHWIPSFAAALVLAIAAFLLDWRIRLERRAQAARGEPTQPQTTH* |
| Ga0137364_109340922 | 3300012198 | Vadose Zone Soil | MDLLLHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARGESTQPQTTH* |
| Ga0137383_109124822 | 3300012199 | Vadose Zone Soil | MDLLLHWIHTLAAALVLTVAAFVLDWRIRAERRAQVARDESTQPQTTH* |
| Ga0137382_108648092 | 3300012200 | Vadose Zone Soil | LLRSPPSGAITDLLLHWIPTLAAALVLTVAAFALDWRIRAERRAQVARDESTQPQTTH* |
| Ga0137365_104718452 | 3300012201 | Vadose Zone Soil | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQPQTTL* |
| Ga0137399_109214652 | 3300012203 | Vadose Zone Soil | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRTQAARGESAQPQSTH* |
| Ga0137380_106484323 | 3300012206 | Vadose Zone Soil | LLHWIPTLAAALVLTIAGFVLDWRIRAERRARAARGKSTQPQTTH* |
| Ga0137380_115514071 | 3300012206 | Vadose Zone Soil | MSFLVRWIPALAGGFVLLIASWVLETRIRAERRARATRGE |
| Ga0137379_114281942 | 3300012209 | Vadose Zone Soil | MSFLVRWIPALAGGFVLLIASWVLETRIRAERRAQA |
| Ga0137378_100521734 | 3300012210 | Vadose Zone Soil | MSFLIHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQAQTTH* |
| Ga0137378_107493322 | 3300012210 | Vadose Zone Soil | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRARATRGESTQPQSTH* |
| Ga0137377_104938293 | 3300012211 | Vadose Zone Soil | MDLLLHWIPTLAAALVLTVAAFALDWRIRAERRAQVARDESTQPQTTH* |
| Ga0137370_101100691 | 3300012285 | Vadose Zone Soil | MDLLLHWIPTLAAALVLTIAGFVLDWRIRAGRGAQVARGESTQPQTTH* |
| Ga0137387_109347271 | 3300012349 | Vadose Zone Soil | MAVLIHWIPTLAAALVLTIAGFVLDWRIRAERRAQAARGESTQPQTTH* |
| Ga0137387_109838472 | 3300012349 | Vadose Zone Soil | MDLLLHWIPTLAAALVLTIAGFVLDWRIWAERRAQVARGESAQPQTTH* |
| Ga0137372_100609992 | 3300012350 | Vadose Zone Soil | MTFLSHWIPALAGGVVLLIAAVVLEARIRAERRAQHSRPESTASRPSH* |
| Ga0137386_100627284 | 3300012351 | Vadose Zone Soil | MDLLLHWIPTLAAALVLTIAGFVLDWRIRAERRARAARGKSTQPQTTH* |
| Ga0137386_107829222 | 3300012351 | Vadose Zone Soil | MSFLVRWIPALAGGFVLLIASWVLETRIRAERRAQLARGESTQPQTTH* |
| Ga0137386_109514151 | 3300012351 | Vadose Zone Soil | MDVLLHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARDESTQPQTTH* |
| Ga0137366_111231322 | 3300012354 | Vadose Zone Soil | MDLLLHWIPTLAAALVLMIAGFVLDWRIRAERRAQVARGESTQPQTTH* |
| Ga0137384_106664971 | 3300012357 | Vadose Zone Soil | AVRMMPMSFLVRWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQAQTTH* |
| Ga0137385_108393132 | 3300012359 | Vadose Zone Soil | MDLLLHWIPTLAAALVLMIAGFVLDWRIRAERRAQVACGESTQPQPTH* |
| Ga0134058_11510781 | 3300012379 | Grasslands Soil | RMMPMSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQVARGESTQPQTTH* |
| Ga0134051_10283261 | 3300012398 | Grasslands Soil | RVMPMSFLVHWIPALAGGFVLVIASWVLETRIRAERRAQAARGESTRPQTTH* |
| Ga0134061_12901962 | 3300012399 | Grasslands Soil | MSFLVHWIPALAGGFVLVIASWVLETRIRAERRAQVARGESTQPQTTH* |
| Ga0134048_11451252 | 3300012400 | Grasslands Soil | MSFLVHWIPALAGGFVLVIASSVLETRIRAERRAQAARGESTRPQTTH* |
| Ga0134049_11924753 | 3300012403 | Grasslands Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRAERRAQAARGESTRPHTTH* |
| Ga0134060_13761842 | 3300012410 | Grasslands Soil | MMPMSFLVHWIPALAGGFVLLIASWVLETRIRAERRALVARGESTQPQTTH* |
| Ga0137419_106007231 | 3300012925 | Vadose Zone Soil | MDVMLHWIPTFAAALILAIAAFVLDWRIRVASRAQAARGESTQPQTTH* |
| Ga0137407_103768153 | 3300012930 | Vadose Zone Soil | PMSFLVHWIPALAGGFVLLVASWVLETRIRAERRAQAARGESTQPQTTQ* |
| Ga0134077_103591112 | 3300012972 | Grasslands Soil | MDLLLHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARGESTQP* |
| Ga0134075_100274184 | 3300014154 | Grasslands Soil | MDVLIHWIPTLAAALVLAIAGFVLDWRIRAERRAQVARGESTQPQTTH* |
| Ga0134069_12125362 | 3300017654 | Grasslands Soil | HWIPTLAAALVLTVAAFVLDWRIRAERRAQAARGESTQPQTTQ |
| Ga0134074_12198112 | 3300017657 | Grasslands Soil | MDLLLHWIPTLAAALVLTIAGFVLDWRIRAERRARAARGKSTQPQTTH |
| Ga0134083_102334521 | 3300017659 | Grasslands Soil | MMPMSFLVHWIPALAGGVVLLIASWVLETRIRAERRAQVARGESTQPQTTH |
| Ga0066667_100543273 | 3300018433 | Grasslands Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRAECRAQAARGESTRPQTTH |
| Ga0066667_113705461 | 3300018433 | Grasslands Soil | MDVLIHWIPTLAAALVLTIAGFVLDWRIRAEQRAQVARGESTQPQTTH |
| Ga0209350_10395702 | 3300026277 | Grasslands Soil | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQPQTTH |
| Ga0209234_10423651 | 3300026295 | Grasslands Soil | PMDVLIHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARGESTQPQTTH |
| Ga0209234_10718342 | 3300026295 | Grasslands Soil | PMDVLIHWIPTLAAALVLTIAGFVLDWRIRAEQRAQVARGESTQPQTTH |
| Ga0209235_11495041 | 3300026296 | Grasslands Soil | MDVLLHWIPTLAAALVLAIAGFVLDWRIRAERRAQAARGESTQPQTTH |
| Ga0209238_12103051 | 3300026301 | Grasslands Soil | MDLLLHWIPTLAAALVVTVAAFVLDWRIRAERRAQVARGESTQPQTTQ |
| Ga0209239_10346404 | 3300026310 | Grasslands Soil | MDVLLHWIPTFAAALVLAIAGFVLDWRSRAERRARAARGESTQPQTTH |
| Ga0209155_12709981 | 3300026316 | Soil | MSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQPQT |
| Ga0209801_12248462 | 3300026326 | Soil | MDLLLHWIPTLAAALVLTVAAFVLDWRIRAERRAQVARGESTQPQTTQ |
| Ga0209266_10273015 | 3300026327 | Soil | MPMSFLVHWIPALAGGFVLVIVSSVLETRIRAERRAQAARGESTQPQTTH |
| Ga0209266_10831054 | 3300026327 | Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRAERRAQAARGESTRPQTTH |
| Ga0209375_10562273 | 3300026329 | Soil | MPMSFLVHWIPALAGGFVLVIASWVLETRIRAERRAQAARGESTQPQTTH |
| Ga0209803_11646232 | 3300026332 | Soil | MDLLLHWIPTLAAALVVTVAAFVLDWRIRAERRAQVARDESTQPQTTH |
| Ga0209159_11656952 | 3300026343 | Soil | MDLLLHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARDESTQPQTTH |
| Ga0209378_11864742 | 3300026528 | Soil | LKPRSKDDAMSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQAARGESTQPQTTH |
| Ga0209160_10928034 | 3300026532 | Soil | MDVLIHWIPTLAAALVLTIAGFVLDWRIRAERRAQVARGE |
| Ga0209157_11699672 | 3300026537 | Soil | MMPMSFLVHWIPALAGGFVLLIASWVLETRIRAERRAQVARGESTQPQTTH |
| Ga0209590_103282022 | 3300027882 | Vadose Zone Soil | MMPMSFLVHWIPALAGGFVLLVASWVLETRIRAERRAQLARGESTQPQATP |
| Ga0137415_108759061 | 3300028536 | Vadose Zone Soil | MMPMSFLVHWIPALAGGFVLLIASWVLETRIRAERRTQAARGESAQPQSTH |
| Ga0307469_101809841 | 3300031720 | Hardwood Forest Soil | MMRMSFLVHWIPALAAGFVLLIAGWVLETRIRAERRAQAGRGKSTQPQTTH |
| ⦗Top⦘ |