NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102951

Metagenome / Metatranscriptome Family F102951

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102951
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 44 residues
Representative Sequence AQRTGAKLVELPAMVGGVPEAKDYVSFIDYNIRTMLKAVQGG
Number of Associated Samples 83
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.99 %
% of genes near scaffold ends (potentially truncated) 98.02 %
% of genes from short scaffolds (< 2000 bps) 94.06 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(25.743 % of family members)
Environment Ontology (ENVO) Unclassified
(30.693 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.535 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.57%    β-sheet: 0.00%    Coil/Unstructured: 71.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF00005ABC_tran 79.21
PF00950ABC-3 8.91
PF01297ZnuA 2.97
PF13304AAA_21 1.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 8.91
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 8.91
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 8.91

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_102802457All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300000955|JGI1027J12803_102844819All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300004114|Ga0062593_101128030All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300004801|Ga0058860_11787017All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300005166|Ga0066674_10268046All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300005166|Ga0066674_10314008All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300005167|Ga0066672_10220031All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni1215Open in IMG/M
3300005177|Ga0066690_10172058All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni1432Open in IMG/M
3300005177|Ga0066690_10843138All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300005177|Ga0066690_10870155All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300005177|Ga0066690_10925091All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005178|Ga0066688_10784023All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300005440|Ga0070705_101521057All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005467|Ga0070706_100695674All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300005467|Ga0070706_101688009All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005491|Ga0074212_116440All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300005518|Ga0070699_100093235All Organisms → cellular organisms → Bacteria2635Open in IMG/M
3300005518|Ga0070699_102025593All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005540|Ga0066697_10587420All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005540|Ga0066697_10601074All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300005545|Ga0070695_101470155All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005548|Ga0070665_100930263All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300005553|Ga0066695_10531275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300005557|Ga0066704_10713350All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium631Open in IMG/M
3300005557|Ga0066704_10892978All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium550Open in IMG/M
3300005559|Ga0066700_10854191All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005559|Ga0066700_11110828All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005561|Ga0066699_10402183All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni980Open in IMG/M
3300005569|Ga0066705_10069974All Organisms → cellular organisms → Bacteria2023Open in IMG/M
3300005569|Ga0066705_10118576All Organisms → cellular organisms → Bacteria1593Open in IMG/M
3300005618|Ga0068864_102009629All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300005764|Ga0066903_104530971All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes741Open in IMG/M
3300006046|Ga0066652_101026430All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300006049|Ga0075417_10658504All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300006794|Ga0066658_10479816All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300006796|Ga0066665_11435452All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300006797|Ga0066659_11673827All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300006806|Ga0079220_11539764All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300006852|Ga0075433_10698844All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300006854|Ga0075425_101276137All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300006871|Ga0075434_101981100All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300006904|Ga0075424_101414039All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300006954|Ga0079219_12203995All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300006969|Ga0075419_10646880All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300009012|Ga0066710_104222668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300009100|Ga0075418_12670604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300009137|Ga0066709_102521300All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300009137|Ga0066709_104556865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300009156|Ga0111538_10492373All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300009162|Ga0075423_10097723All Organisms → cellular organisms → Bacteria3070Open in IMG/M
3300009162|Ga0075423_10350818All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300009162|Ga0075423_10793168All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300009162|Ga0075423_11620495All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium696Open in IMG/M
3300010304|Ga0134088_10377100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300010398|Ga0126383_10970854All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300010403|Ga0134123_12497807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300011271|Ga0137393_11369222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300011429|Ga0137455_1177869All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300012096|Ga0137389_10509889All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1032Open in IMG/M
3300012200|Ga0137382_10300475All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300012205|Ga0137362_11213803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium639Open in IMG/M
3300012207|Ga0137381_11214778All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300012351|Ga0137386_10411236All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300012359|Ga0137385_11401730All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300012930|Ga0137407_10470316All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300014326|Ga0157380_10622085All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300014745|Ga0157377_10314651All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300015371|Ga0132258_11092219All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300016294|Ga0182041_12147993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300016319|Ga0182033_10506700All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300017966|Ga0187776_11439579All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300018058|Ga0187766_11288804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300018482|Ga0066669_10097766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2029Open in IMG/M
3300024330|Ga0137417_1352196All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300025324|Ga0209640_10615710All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300025910|Ga0207684_11226628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300025916|Ga0207663_11502963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300026088|Ga0207641_10601619All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae1076Open in IMG/M
3300026277|Ga0209350_1108686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300026296|Ga0209235_1178444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium785Open in IMG/M
3300026329|Ga0209375_1167245All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300026538|Ga0209056_10410794All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300027568|Ga0208042_1162773All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M
3300028379|Ga0268266_11455043All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium661Open in IMG/M
3300028536|Ga0137415_10824728All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium738Open in IMG/M
3300031421|Ga0308194_10349379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300031682|Ga0318560_10334891All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300031712|Ga0265342_10500399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300031879|Ga0306919_10887683All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300031893|Ga0318536_10257512All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300032076|Ga0306924_12389094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300032180|Ga0307471_100922468All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300032180|Ga0307471_102911145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300032205|Ga0307472_101180345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium730Open in IMG/M
3300032205|Ga0307472_102129666All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium564Open in IMG/M
3300032261|Ga0306920_103550761All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300032828|Ga0335080_12179691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300032829|Ga0335070_10141553All Organisms → cellular organisms → Bacteria2458Open in IMG/M
3300032829|Ga0335070_11656536All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300034664|Ga0314786_022658All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300034671|Ga0314796_026259All Organisms → cellular organisms → Bacteria990Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil25.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.88%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.98%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.99%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.99%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.99%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.99%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004801Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005491Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Formaldehyde enrichmentEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034671Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10280245723300000955SoilELHYPAGLASTVAQSTGAKLVEIPSMVRGVSEAKDYISFIDYNVRTLVNAVKGG*
JGI1027J12803_10284481913300000955SoilKLVEIPSMVRGVPEAKDYISLIDYNVRTLVNAVKGG*
Ga0062593_10112803013300004114SoilAQSTGATLVELPAMVGGVPEAKDYLSFIDYNLRTVLKAVQKGT*
Ga0058860_1178701713300004801Host-AssociatedIAQRTGATLVELPAMVGGVPEAKDYVSLIDYNLRTVLKAVQKGT*
Ga0066674_1026804613300005166SoilAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQSS*
Ga0066674_1031400813300005166SoilAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQGS*
Ga0066672_1022003113300005167SoilATGAKLVELPAMTGGVPEAKTYMGFIDYNVRTLIKAVTGG*
Ga0066690_1017205813300005177SoilRERHYPAGLAETIARETGAKLVELPAMTGGVPEAKDYISFIDYNVRTMVKAVTGG*
Ga0066690_1084313813300005177SoilAESVAKAAGATLVELPVMSGGIPEAKDYIGFLDYNVRTMVKAVQGS*
Ga0066690_1087015513300005177SoilRHYPAGLAETVAKATGAKLVELPAMVGGVPEADNYIAFIDYNIRALVKAATGG*
Ga0066690_1092509113300005177SoilRELSYPANLAETIARETGAKLVELPSMAGGVPGVKDYISFVDYCIRTMVKAVTAG*
Ga0066688_1078402313300005178SoilLAETVAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQSS*
Ga0070705_10152105713300005440Corn, Switchgrass And Miscanthus RhizosphereAGLAETVAQATGAKLVELPAFVGGVPEAKDYISFVDYNLRTMLKAVQGG*
Ga0070706_10069567423300005467Corn, Switchgrass And Miscanthus RhizosphereHYPAALAETIAQRTGAKLVELPAMVGGVPEAKDYVSFIDYNIRTMLKAVQGG*
Ga0070706_10168800923300005467Corn, Switchgrass And Miscanthus RhizosphereIAQRTGAKLVELPAMVGGVPEAKDYLSFIDYNIRTMLKAVQGG*
Ga0074212_11644033300005491SedimentAQQTGAKLVELPVMVGGVPEATDYVSFIDYNLHTMLKALQGGA*
Ga0070699_10009323543300005518Corn, Switchgrass And Miscanthus RhizosphereGLAETVAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQGS*
Ga0070699_10202559323300005518Corn, Switchgrass And Miscanthus RhizosphereAQRTGAKLVELPAMVGGVPEAKDYVSFIDYNIRTMLKAVQGG*
Ga0066697_1058742023300005540SoilQATGAKLVELPAFVGGVPQAKDYISFVDYNLHTMLKAVQSS*
Ga0066697_1060107423300005540SoilLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQSS*
Ga0070695_10147015513300005545Corn, Switchgrass And Miscanthus RhizosphereETIAQSTGATLVELPAMVGGVPEAKDYLSFIDYNLRTVLKAVQKGT*
Ga0070665_10093026323300005548Switchgrass RhizosphereQSTGATLVELPAMVGGVPEAKDYLSFIDYNLRTVLKAVQKGT*
Ga0066695_1053127523300005553SoilKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQGS*
Ga0066704_1071335023300005557SoilLVELPAMTGGVPEARDYISFIDYNVRTMVKAVTGG*
Ga0066704_1089297823300005557SoilKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQGG*
Ga0066700_1085419113300005559SoilYPANLAATVAQETGAKLVELPSMAGGVPGGTDYISFVDYCVRTMVKAVTAG*
Ga0066700_1111082813300005559SoilAQTVAQHTGAKLVELPAMVGGVPEAKDYVSFIDYNIRTMLKVVQGG*
Ga0066699_1040218313300005561SoilPAGLAETVAKATGAKLVELPAMVGGVPEADNYIAFIDYNIRALVKAATGG*
Ga0066705_1006997443300005569SoilLVELPAMTGGVPEAKNYISFIDYNVRTLVKAVTGG*
Ga0066705_1011857633300005569SoilAKLVELPVMVGGVPEAKDYISFIDYDLQTMLKAVKGS*
Ga0068864_10200962923300005618Switchgrass RhizosphereLAETVAQATGAKLVELPVMAGGLPETKDYISFVDYNVRTMLKAVQGG*
Ga0066903_10453097113300005764Tropical Forest SoilETVAQATGAKLVELPAMAGGLPDTKDYIGFIDHNVRTMVAAVQGG*
Ga0066652_10102643013300006046SoilAGLAESVAQTAGAKLVELPVMSGGLPETKDYISFLDYNLRTMLKAVQGS*
Ga0075417_1065850413300006049Populus RhizosphereRTGAKLVELPAMVGGVPEARDYVSFIDYNIRTMLKVVQGG*
Ga0066658_1047981613300006794SoilAKLVELPAMVRGVPEAKDYISFVDYNVRTLVKAVKGG*
Ga0066665_1143545213300006796SoilKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQSS*
Ga0066659_1167382713300006797SoilLVELPSMVGGVPEAKDYISFIDYNLHQMLKAVQGT*
Ga0079220_1153976423300006806Agricultural SoilETVAKATGAKLVELPTMAGGQPETKTYLSFIDYNVRTLLKAVTGG*
Ga0075433_1069884413300006852Populus RhizosphereKLVELPVMAGGLPDTKDYISFIDHNVKTMVRALSGG*
Ga0075425_10127613713300006854Populus RhizosphereATLVELPAMVGGVPEAKDYLSFIDYNLRTVLKAVQKGT*
Ga0075434_10198110013300006871Populus RhizosphereAETIAQRTGAKLVELPAMVGGVPEARDYVSFIYYNIRTMLKGVQGG*
Ga0075424_10141403923300006904Populus RhizosphereLAETIAQSTGAKLVELPAMVGGVPEAKDYLSFIDYNLHTVLKAVQKGA*
Ga0079219_1220399513300006954Agricultural SoilMKQAKTDVVIREKHYPASLAETVARAANTKLVELPTMAGGQPETKTWLSFIDYNVRTLVKAVTGG*
Ga0075419_1064688023300006969Populus RhizosphereARRTGAKLVELPTMVGGVPEARDYVSFIDYNIRTMLKVLQGG*
Ga0066710_10422266813300009012Grasslands SoilKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQSS
Ga0075418_1267060413300009100Populus RhizosphereTIAQRTGATLVELPAMVGGVPEAKDYVSFIDYNLRTVLKAVQKGT*
Ga0066709_10252130023300009137Grasslands SoilRERHYPAGLAETVAKATGAKLVELPAMVGGVPEADNYIAFIDYNVRTLVKAATGG*
Ga0066709_10455686523300009137Grasslands SoilVAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQSS*
Ga0111538_1049237313300009156Populus RhizosphereTIAQRTGATLVELPAMVGGVPEARDYVSFIDYNIRTMLKGLQGG*
Ga0075423_1009772313300009162Populus RhizosphereIRELHYPAGLAATVAQSTGAKLVELPAMTRGVPEAKDYISFIDYNVRTLVKAATGG*
Ga0075423_1035081823300009162Populus RhizosphereVQLPSMVGGVPEAKDYISFIDYNLHTMLKAAQGG*
Ga0075423_1079316833300009162Populus RhizosphereRHYPAGLAETIAQRTGAKLVELPAMVGGVPEAKDYVSFIDYNIRTMLKVVQGG*
Ga0075423_1162049513300009162Populus RhizosphereAKLVELPAMVGGVPEARDYVSFIDYNIRTMLKVVQGG*
Ga0134088_1037710023300010304Grasslands SoilATGAKLVELPAFVGGVPQAKDYISFVDYNLHTMLKAVQGS*
Ga0126383_1097085433300010398Tropical Forest SoilAQRTGAQLVELPAMVGGVPEARDYVSFIDYNIRTMLKAVQGG*
Ga0134123_1249780723300010403Terrestrial SoilLAETVAQATGTKLVELPVMAGGLPDTKDYISFVDHNVRTMVQALRGG*
Ga0137393_1136922213300011271Vadose Zone SoilAKLVELPAFVGGVPEAKDYISFVDYNVHTMLKAVQGG*
Ga0137455_117786923300011429SoilAETIAQRTGAKLVELPAMVGGVPEARDYVSFIDYNIRTMLKGLQGE*
Ga0137389_1050988923300012096Vadose Zone SoilAGLAETIAQNTGAKLAELPAMVGGVPEAKDYLSFIDYNLRTVLKAVQGG*
Ga0137382_1030047533300012200Vadose Zone SoilPAGLAESVAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQGS*
Ga0137362_1121380323300012205Vadose Zone SoilALAETIAQRTGSKLVELPAMVGGVPEAKDYLSFIDYNIRTMLKGVQGG*
Ga0137381_1121477813300012207Vadose Zone SoilTIAQRTGAKLVELPVMVGGVPEAKDYVSFIDYNIRTMLKAVQGG*
Ga0137386_1041123633300012351Vadose Zone SoilGARLVELPVMVGGVPEAKDYLSFIDYNIRTMLKAVQGG*
Ga0137385_1140173023300012359Vadose Zone SoilLAETIAQRTGAKLVELPVMVGGVPEAKDYVSFIDYNIRTMLKAVQGG*
Ga0137407_1047031613300012930Vadose Zone SoilPAGLAETVAQATGAKLVELPVMAGGLPDTKDYISFVDHNVRTMLQALKGS*
Ga0157380_1062208533300014326Switchgrass RhizosphereGATLVELPAMVGGVPEARDYVSFIDYNIRTMLKGLQGG*
Ga0157377_1031465113300014745Miscanthus RhizosphereVELPAMVGGVPEAKDYLSFIDYNLRTVLKAVQKGT*
Ga0132258_1109221943300015371Arabidopsis RhizosphereVELPAMVGGVPEAKDYLIFIDYNLHTVLKAVQKGT*
Ga0182041_1214799313300016294SoilGAKLVELPVMVGGVPEAKDYISFIDYNVRTMLKAVEGG
Ga0182033_1050670033300016319SoilLVELPCMVGGVPEARDYVSFIDYNMRTMLKAVQGG
Ga0187776_1143957923300017966Tropical PeatlandETVAQATGAKLVELPVMAGGTPETRDYISFIDYNVRTMLKAVQGGA
Ga0187766_1128880423300018058Tropical PeatlandRGGAKLIELPVMVGGVPEAKTYAGLIDYNLHAMLKAVQGSG
Ga0066669_1009776643300018482Grasslands SoilAKLVELPVMSGGLPETKDYISFLDYNLRTMLKAVQGS
Ga0137417_135219643300024330Vadose Zone SoilSSTGAKLVELPSMVRGTPEAKDYISLIDYNVRTLVKAVTGS
Ga0209640_1061571013300025324SoilYPAALADTVAQRTGAKLVELPVMVGGVSEGKTYVSFIDYNLHALLKAVQGGA
Ga0207684_1122662823300025910Corn, Switchgrass And Miscanthus RhizosphereTGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQGG
Ga0207663_1150296323300025916Corn, Switchgrass And Miscanthus RhizosphereLAETVAQATGAKLVELPAMVGGVPEAKDYISFVDYNLHTMLKAVNAS
Ga0207641_1060161933300026088Switchgrass RhizosphereNLAATVAEATGAKLVELPCMVGGVPEAKDYISFIDYNLHTMLKAVQGS
Ga0209350_110868613300026277Grasslands SoilYPAGLAETVAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQSS
Ga0209235_117844413300026296Grasslands SoilLAETVAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQGG
Ga0209375_116724523300026329SoilTVAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQGS
Ga0209056_1041079423300026538SoilTVAQATGAKLVELPAFVGGVPEAKDYISFVDYNLHTMLKAVQSS
Ga0208042_116277313300027568Peatlands SoilRTGAKLVELPAMVGGVPEAKDYVGLIDYNLHAMLRAVQGGA
Ga0268266_1145504313300028379Switchgrass RhizosphereQSTGATLVELPAMVGGVPEAKDYLSFIDYNLRTVLKAVQKGT
Ga0137415_1082472823300028536Vadose Zone SoilMFELPVMVGGVPEAKDYISFIDYNVHTMLKAVKGS
Ga0308194_1034937913300031421SoilYPAGLAETIAQRTGAKLVELPVMVGGVPEARNYVSFIDYNIRTMLKGVQGG
Ga0318560_1033489123300031682SoilYPAALAETVAQATGAKLVELPTMVGGVPEAKDYASFIEYTIRTLLKATGSAPG
Ga0265342_1050039923300031712RhizosphereERHYPAGLAETVAQRTGAKLVELPVMVGGVPEATTYVALIDYNLHALLKAVQSGT
Ga0306919_1088768313300031879SoilREVSYPAALAATVAQATDATLVELPTMVGGVPEAKDYASFIDFNIRTLLKAAGNAPK
Ga0318536_1025751223300031893SoilVQYPAGLAESVAQATGAKLVELPVMTGGVPQATDYISFIDYNLHTMLQAVQGGA
Ga0306924_1238909423300032076SoilLVELPVMTGGVPQATDYISFIDYNLHTMLQAVQGGA
Ga0307471_10092246813300032180Hardwood Forest SoilYPAGLAETVAQATGAKLVELPAMVGGVPQAKDYISFVDYNLQTMLKAVQGS
Ga0307471_10291114533300032180Hardwood Forest SoilGAKLVDLPLMVGGVPEATDYISFIDYIIGALVNASEGGHTTTSR
Ga0307472_10118034513300032205Hardwood Forest SoilLAETVAQATGAKLVELPVMAGGLPDTKDYISFVDHNVRTMLRALKGG
Ga0307472_10212966633300032205Hardwood Forest SoilRELHYPAGLAETIARQTGAKLVELPAMAGGMPETKDYISFVDYNVRTMVKAATAR
Ga0306920_10355076123300032261SoilETIAQQTGAKLVELPAMVNGVPEAKDYIGLIDYNLHAMLNAVKTG
Ga0335080_1217969123300032828SoilTGATLVELPAMMTGGVPQAPDYISFIDYNPHTMLKAVQGGA
Ga0335070_1014155343300032829SoilYPAGLAETIAQETGAKLVELPAMVGGVPEAKDYISFIDYNVRTMLKAVQGG
Ga0335070_1165653623300032829SoilSVAQATGAKLVELPAMAGGVPQATDYISFIDYNVHTMLQAVQGGA
Ga0314786_022658_881_10213300034664SoilAQTIAQRTGAKLVELPAMVGGVPEARDYVSFIDYNIRTMLKAVQGG
Ga0314796_026259_882_9893300034671SoilLVELPAMVGGVPEARDYVSFIDYNIRTMLKAVQGG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.