Basic Information | |
---|---|
Family ID | F102933 |
Family Type | Metagenome |
Number of Sequences | 101 |
Average Sequence Length | 43 residues |
Representative Sequence | RARAERSFSHLVMAEEYVRMYRSVLETGTLPPGRPTP |
Number of Associated Samples | 81 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.00 % |
% of genes near scaffold ends (potentially truncated) | 97.03 % |
% of genes from short scaffolds (< 2000 bps) | 80.20 % |
Associated GOLD sequencing projects | 75 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.62 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.010 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.733 % of family members) |
Environment Ontology (ENVO) | Unclassified (56.436 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.386 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF13524 | Glyco_trans_1_2 | 44.55 |
PF13692 | Glyco_trans_1_4 | 7.92 |
PF00005 | ABC_tran | 4.95 |
PF00664 | ABC_membrane | 3.96 |
PF09594 | GT87 | 3.96 |
PF13439 | Glyco_transf_4 | 2.97 |
PF12996 | DUF3880 | 1.98 |
PF13489 | Methyltransf_23 | 1.98 |
PF00534 | Glycos_transf_1 | 1.98 |
PF05685 | Uma2 | 0.99 |
PF08665 | PglZ | 0.99 |
PF05050 | Methyltransf_21 | 0.99 |
PF09557 | DUF2382 | 0.99 |
PF13231 | PMT_2 | 0.99 |
PF01797 | Y1_Tnp | 0.99 |
PF03901 | Glyco_transf_22 | 0.99 |
PF01075 | Glyco_transf_9 | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.99 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.01 % |
Unclassified | root | N/A | 0.99 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002560|JGI25383J37093_10032197 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
3300002562|JGI25382J37095_10133772 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300002915|JGI25387J43893_1050591 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300002916|JGI25389J43894_1073599 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300005172|Ga0066683_10364283 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300005175|Ga0066673_10028595 | All Organisms → cellular organisms → Bacteria | 2655 | Open in IMG/M |
3300005179|Ga0066684_10047842 | All Organisms → cellular organisms → Bacteria | 2435 | Open in IMG/M |
3300005181|Ga0066678_10013984 | All Organisms → cellular organisms → Bacteria | 4021 | Open in IMG/M |
3300005186|Ga0066676_10037272 | All Organisms → cellular organisms → Bacteria | 2688 | Open in IMG/M |
3300005336|Ga0070680_101936579 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005447|Ga0066689_10057163 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
3300005471|Ga0070698_100871832 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005529|Ga0070741_10575182 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300005545|Ga0070695_101801534 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005555|Ga0066692_10517065 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300005559|Ga0066700_10492419 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005560|Ga0066670_10079607 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
3300005568|Ga0066703_10087905 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
3300005569|Ga0066705_10032282 | All Organisms → cellular organisms → Bacteria | 2825 | Open in IMG/M |
3300005569|Ga0066705_10566554 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300005833|Ga0074472_10775229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 793 | Open in IMG/M |
3300005836|Ga0074470_10858142 | All Organisms → cellular organisms → Bacteria | 3729 | Open in IMG/M |
3300006796|Ga0066665_10167257 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
3300006796|Ga0066665_10234765 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
3300006796|Ga0066665_10258463 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300006797|Ga0066659_10804179 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300006914|Ga0075436_100211620 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
3300006914|Ga0075436_101210553 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300006954|Ga0079219_12033164 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300009012|Ga0066710_100993177 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1295 | Open in IMG/M |
3300009012|Ga0066710_101206960 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300009012|Ga0066710_102136883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 821 | Open in IMG/M |
3300009012|Ga0066710_104312611 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300009137|Ga0066709_100299194 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2184 | Open in IMG/M |
3300009137|Ga0066709_100891829 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1295 | Open in IMG/M |
3300009137|Ga0066709_102413336 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300009143|Ga0099792_10315650 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300009147|Ga0114129_12055240 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300009162|Ga0075423_10942567 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300009162|Ga0075423_11495584 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300010301|Ga0134070_10177935 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 772 | Open in IMG/M |
3300010301|Ga0134070_10292899 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300010333|Ga0134080_10016352 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
3300010336|Ga0134071_10076497 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1561 | Open in IMG/M |
3300010337|Ga0134062_10603734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 565 | Open in IMG/M |
3300010362|Ga0126377_10093288 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
3300012198|Ga0137364_10420585 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300012201|Ga0137365_10352220 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300012353|Ga0137367_10458100 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300012355|Ga0137369_10775168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 655 | Open in IMG/M |
3300012355|Ga0137369_10985638 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012358|Ga0137368_10108674 | All Organisms → cellular organisms → Bacteria | 2132 | Open in IMG/M |
3300012359|Ga0137385_10337577 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300012359|Ga0137385_11013650 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300012361|Ga0137360_11416747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
3300012361|Ga0137360_11760829 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 525 | Open in IMG/M |
3300012532|Ga0137373_10015841 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7664 | Open in IMG/M |
3300012927|Ga0137416_10074060 | All Organisms → cellular organisms → Bacteria | 2481 | Open in IMG/M |
3300012944|Ga0137410_10005089 | All Organisms → cellular organisms → Bacteria | 8958 | Open in IMG/M |
3300012944|Ga0137410_10856635 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300012976|Ga0134076_10128311 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300014157|Ga0134078_10117797 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300015356|Ga0134073_10213763 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300015359|Ga0134085_10073048 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
3300015359|Ga0134085_10412171 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300017656|Ga0134112_10194260 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 792 | Open in IMG/M |
3300017656|Ga0134112_10222785 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300017927|Ga0187824_10281390 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300018468|Ga0066662_10362840 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
3300019878|Ga0193715_1008308 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2223 | Open in IMG/M |
3300020010|Ga0193749_1002446 | All Organisms → cellular organisms → Bacteria | 3495 | Open in IMG/M |
3300025922|Ga0207646_11603956 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300026277|Ga0209350_1159952 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
3300026296|Ga0209235_1261311 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300026297|Ga0209237_1122531 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300026297|Ga0209237_1250952 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300026298|Ga0209236_1101927 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300026308|Ga0209265_1038226 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
3300026313|Ga0209761_1284060 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300026325|Ga0209152_10048850 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
3300026332|Ga0209803_1151387 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300026334|Ga0209377_1191051 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
3300026335|Ga0209804_1139031 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1093 | Open in IMG/M |
3300026343|Ga0209159_1110434 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300026530|Ga0209807_1021455 | All Organisms → cellular organisms → Bacteria | 3142 | Open in IMG/M |
3300026530|Ga0209807_1143387 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300026540|Ga0209376_1380197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
3300026542|Ga0209805_1195734 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300026542|Ga0209805_1344432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
3300026548|Ga0209161_10119851 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300027875|Ga0209283_10030389 | All Organisms → cellular organisms → Bacteria | 3367 | Open in IMG/M |
3300027903|Ga0209488_11149847 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
3300031753|Ga0307477_10450453 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300031949|Ga0214473_11770737 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
3300032180|Ga0307471_100220404 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
3300032783|Ga0335079_11651891 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 628 | Open in IMG/M |
3300032897|Ga0335071_10536911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus | 1122 | Open in IMG/M |
3300033502|Ga0326731_1006059 | All Organisms → cellular organisms → Bacteria | 3120 | Open in IMG/M |
3300033803|Ga0314862_0159791 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 549 | Open in IMG/M |
3300033813|Ga0364928_0058957 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 856 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 17.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.88% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.99% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.99% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.99% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.99% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.99% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25383J37093_100321973 | 3300002560 | Grasslands Soil | LAEWDPHACRARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP* |
JGI25382J37095_101337722 | 3300002562 | Grasslands Soil | ACRAHAERYFTHITMAEQYVSLYRNLLATGALGPGRPTPYTIM* |
JGI25387J43893_10505911 | 3300002915 | Grasslands Soil | IETRSAAACRTHAERYFSHITMAEQYVRLYRNLLATGALGPGQSIPYTTS* |
JGI25389J43894_10735991 | 3300002916 | Grasslands Soil | NPHACRARAERYFSHLVMAEEYVRMYRSLLDTGKLPPGRPTP* |
Ga0066683_103642832 | 3300005172 | Soil | WDPHACRARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP* |
Ga0066673_100285954 | 3300005175 | Soil | RSPEACRAHAQRFFTHIVMAEEYLRMYRHLIETGGLPSGRSTPSVPA* |
Ga0066684_100478421 | 3300005179 | Soil | YACRAHAERHFSHLVMTQEYLRMYRGLLETGRLPPGRPAGHLARTG* |
Ga0066678_100139841 | 3300005181 | Soil | DPEACRAHAERNFSHLVMAQEYERMYHAVLETGTLPPGRPAPHLATAG* |
Ga0066676_100372725 | 3300005186 | Soil | RSPQACRAFAERQFTHLVMAEEYVRMYRCLLDTGKLPPGRTLAPPAA* |
Ga0070680_1019365791 | 3300005336 | Corn Rhizosphere | RDPAACRAYAEQYFSHVVMAEEYLRMYRSLLDTGSLPPGRVTPHAPTATSP* |
Ga0066689_100571633 | 3300005447 | Soil | LRGRLADWDPRACRARAERSFSHLVMAEEYVRMYRSVLEIGTLPPGRPTP* |
Ga0070698_1008718321 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | CRAHAARFFTHAVMAEEYVRVYGHLLATGTLPPGRPTPYAPA* |
Ga0070741_105751821 | 3300005529 | Surface Soil | PLACRAHAERHFTHIVMATEYERMYRHLLDTGTLPAGMATSGA* |
Ga0070695_1018015341 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LADWDPRACRARAERSFSHLVMADEYLRMYRAVLETGTLPPGRPTA* |
Ga0066692_105170651 | 3300005555 | Soil | RARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP* |
Ga0066700_104924191 | 3300005559 | Soil | ARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP* |
Ga0066670_100796071 | 3300005560 | Soil | QTRSPAVCRAHAERYFSHRVMAQEYVRMYRSLLETGRLPAGRAMPHLATAG* |
Ga0066703_100879053 | 3300005568 | Soil | FFTHAVMAEEYVRVYGHLLATGTLPPGRPTPYAPA* |
Ga0066705_100322821 | 3300005569 | Soil | TRDPSACRAHAERYFTHLVMAEEYTRLYRRLLETGRLPPGRPAPHLATAG* |
Ga0066705_105665542 | 3300005569 | Soil | CRAHAERHFSHLVMAQEYLRMYRGLLEAGRLPPGRPAPHLATAG* |
Ga0074472_107752291 | 3300005833 | Sediment (Intertidal) | QKDPHACRARAERYFSHLVMADAYVRCYRHFLAEGRLPEGVSSEQ* |
Ga0074470_108581424 | 3300005836 | Sediment (Intertidal) | RRPETCRAHAERYFTQRVMAEEYVRVYRHLAETGEVPAGRATPWAP* |
Ga0066665_101672573 | 3300006796 | Soil | ALRGRLADWDPRACRARAERSFSHLVMAEEYVRMYRSVLEIGTLPPGRPTP* |
Ga0066665_102347653 | 3300006796 | Soil | ALRGRLADWDPRACRARAERSFSHLVMAEEYVRMYRSVLETGTLPPGRSTP* |
Ga0066665_102584631 | 3300006796 | Soil | CRARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP* |
Ga0066659_108041792 | 3300006797 | Soil | EWDPHACRARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP* |
Ga0075436_1002116203 | 3300006914 | Populus Rhizosphere | TRSPEACRAHATRYFSHLVMAAEYVRLYRHLIAHGELPPGRPTPYTTT* |
Ga0075436_1012105532 | 3300006914 | Populus Rhizosphere | AEACRAHAERYFSHVRMAEEYVRVYRHLIATGTLPPGRATPYTTT* |
Ga0079219_120331642 | 3300006954 | Agricultural Soil | RAHAARYFTHAVMAEEYVRVYGHLLATGTLPPGRPTPYAPA* |
Ga0066710_1009931772 | 3300009012 | Grasslands Soil | ALRGRLADWDPRACRARAERSFSHLVMAEEYVRMYRSVLETGTLPPGRSTP |
Ga0066710_1012069602 | 3300009012 | Grasslands Soil | RGRLAEWDPHACRARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP |
Ga0066710_1021368832 | 3300009012 | Grasslands Soil | GACRAHAERFFTHLVMAGEYLRMYRHVLETGTLPAGRTTSFVAA |
Ga0066710_1043126112 | 3300009012 | Grasslands Soil | RGRLAEWDPHACRARAERSFSHLVMTQEYVRMYRAYLETGGLPPGRPTP |
Ga0066709_1002991941 | 3300009137 | Grasslands Soil | ACRALAERRFTHVVMAEEYVRMYRCLLDTGKLAPGRPVAGPNGS* |
Ga0066709_1008918292 | 3300009137 | Grasslands Soil | ALRGRLADWDPRACRARAERSFSHLVMAEEYVRMYRSVLETGTLPPGRPTP* |
Ga0066709_1024133362 | 3300009137 | Grasslands Soil | DPHACRARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP* |
Ga0099792_103156502 | 3300009143 | Vadose Zone Soil | RFFTHAVMAEEYVRLYGHLLATGTLPPGKPTPGAPA* |
Ga0114129_120552401 | 3300009147 | Populus Rhizosphere | GRLADWDPRACRARAERSFSHLVMADEYVRMYRAVLETGTLPPGRATA* |
Ga0075423_109425671 | 3300009162 | Populus Rhizosphere | HAARFFTHAVMAEEYVRLYGHLLATGTLPPGKPTPGAPA* |
Ga0075423_114955841 | 3300009162 | Populus Rhizosphere | ERYFSHLAMAEEYVRMYRALLDTGKLPPGRPTAG* |
Ga0134070_101779352 | 3300010301 | Grasslands Soil | RARAERSFSHLVMAEEYVRMYRSVLETGTLPPGRPTP* |
Ga0134070_102928991 | 3300010301 | Grasslands Soil | GRLADWDPRACRARAERSFSHLVMTSEYVRMYRSLLESGTLPPGRPTP* |
Ga0134080_100163524 | 3300010333 | Grasslands Soil | ACRARAERLFTHVRMAEEYVRMYDALKKKGTLPPGRTVD* |
Ga0134071_100764973 | 3300010336 | Grasslands Soil | RAERYFSHLVMAEEYVRMYRSLLDTGKLPPGRPTP* |
Ga0134062_106037341 | 3300010337 | Grasslands Soil | HTRNPHACRARAERYFSHLVMAEEYVRMYRSLLDTGKLPPGRPTP* |
Ga0126377_100932884 | 3300010362 | Tropical Forest Soil | RDPLACRAHAERYFTHVVMADEYVRMYRQLLASGTLPAGRATPAA* |
Ga0137364_104205852 | 3300012198 | Vadose Zone Soil | RFFTHAVMAEEYVRVYGHLLATGTLPPGRPTPNAPA* |
Ga0137365_103522202 | 3300012201 | Vadose Zone Soil | TRSPQACRTLAERQFTHLVMAQEYVRMYRCLLDTGKLPPGRPTAAA* |
Ga0137367_104581001 | 3300012353 | Vadose Zone Soil | VRRARAERFFTHVVMAEEYLRMYRHLLETGTLPPGRVTPCAPT* |
Ga0137369_107751681 | 3300012355 | Vadose Zone Soil | VRRARAERFFTHVVMAEEYLRMYRHLLETGTLPPGRV |
Ga0137369_109856381 | 3300012355 | Vadose Zone Soil | AHAERYFTHLTMAERYLRMYRCLVETGVLPPGEPTPRTAA* |
Ga0137368_101086743 | 3300012358 | Vadose Zone Soil | ERYFTHLVMAEEYVRMYRAVIETGTLPAGRPTPSLQASS* |
Ga0137385_103375771 | 3300012359 | Vadose Zone Soil | RAHAERCFTHVVMAEEYLRMYHHVLDTGVLPPGRPTPGVAQ* |
Ga0137385_110136501 | 3300012359 | Vadose Zone Soil | ERYFSHHVMAQEYVRMYRSLLETGRLPAGRAMPHLATAG* |
Ga0137360_114167471 | 3300012361 | Vadose Zone Soil | FTHWVMAEEYVRVYRAVIETGKLPAGRPTPYASS* |
Ga0137360_117608292 | 3300012361 | Vadose Zone Soil | EACRAHATRYFSHVVMAEEYVRVYRHLLAHGELPPGRPTPYTTT* |
Ga0137373_100158412 | 3300012532 | Vadose Zone Soil | VRRARAERFFTHVVMAEEYLRMYRHLLETGTLPPGRVAPCAPT* |
Ga0137416_100740601 | 3300012927 | Vadose Zone Soil | RAERSFSHLVMADEYLRMYRAVLETGTLPPGRPTA* |
Ga0137410_1000508911 | 3300012944 | Vadose Zone Soil | RAHAERYFTHRAMAEGYVRAYRAVIETGNPPAGRPTPYASS* |
Ga0137410_108566351 | 3300012944 | Vadose Zone Soil | ACRARAERSFSHLVMADEYLRMYRAVLETGSLPPGRPTA* |
Ga0134076_101283112 | 3300012976 | Grasslands Soil | CRALAERHFTHVAMAEEYLRMYRALLDTGKLPAGRATPHAASAVPR* |
Ga0134078_101177971 | 3300014157 | Grasslands Soil | IHTRSPQACRTLAERQFTHLVMAQEYVRMYRCLLDTGKLPPGRPTAAA* |
Ga0134073_102137631 | 3300015356 | Grasslands Soil | HAERYFTHLVMAEEYTRLYRRLLETGRLPPGRPAPHLATAG* |
Ga0134085_100730483 | 3300015359 | Grasslands Soil | AHAERYFTHLVMAEEYVRMYRAVIETGTLPAGRPTPSLQASS* |
Ga0134085_104121711 | 3300015359 | Grasslands Soil | PHACRARAERYFSHLVMAEEYVRMYRSLLDTGKLPPGRPTP* |
Ga0134112_101942601 | 3300017656 | Grasslands Soil | AHATRYFTHITMAEEYVRVYHHLIANGALPPGRPTS |
Ga0134112_102227851 | 3300017656 | Grasslands Soil | AACRAHAERYFSHVVMAEEYVRMYRALLDTGTLPPGRPTP |
Ga0187824_102813901 | 3300017927 | Freshwater Sediment | TRSAAACRAHAERYFTHRVMAAAYVRMYTSILERGALPPGCPTPDAASAG |
Ga0066662_103628401 | 3300018468 | Grasslands Soil | TRDPGACRAHAARFFTHAVMAEEYVRLYGQLLATGTLPPGRPTPDAPA |
Ga0193715_10083081 | 3300019878 | Soil | CRARAERSFSHLVMADEYVRMYRALLATGTLPPGRPTPG |
Ga0193749_10024461 | 3300020010 | Soil | YFTHRTMAEEYVRVYRAVIETGNPPAGRPTPYASS |
Ga0207646_116039562 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AARFFTHAVMAEEYVRVYGHLLATGTLPPGRPTPYAPA |
Ga0209350_11599521 | 3300026277 | Grasslands Soil | HTRNPEACRAHAERHFSHLVMAQEYVRMYRSVLETGTLPPGRLAPHLATAR |
Ga0209235_12613112 | 3300026296 | Grasslands Soil | AETIHTREPHACRARAERYFSHLVMAEEYVRMYRAVLETGTLPPGRPTP |
Ga0209237_11225312 | 3300026297 | Grasslands Soil | CRARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP |
Ga0209237_12509521 | 3300026297 | Grasslands Soil | ERYFSHHVMAQEYVRMYRSLLETGRLPAGRAMPHLATAG |
Ga0209236_11019271 | 3300026298 | Grasslands Soil | FFTHAVMAEEYVRVYGHLLATGTLPPGRPTPYAPA |
Ga0209265_10382263 | 3300026308 | Soil | VCRAHAERYFSHHVMAEEYVRMYRSLLETGRLPAGRAMPHLATAG |
Ga0209761_12840602 | 3300026313 | Grasslands Soil | YFTHLVMAEEYTRLYRRLLETGRLPPGRPAPHLATAG |
Ga0209155_11228322 | 3300026316 | Soil | IHTRDPAACRARAERHFTHLVMAEEYVRVYGHLLATGTLPPGRPTPNAPA |
Ga0209152_100488503 | 3300026325 | Soil | ACRALAERRFTHVVMAEEYVRMYRCLLDTGKLAPGRPVAGPTGS |
Ga0209803_11513871 | 3300026332 | Soil | ERRFTHVVMAEEYVRMYRCLLDTGKLAPGRPVAGPNGS |
Ga0209377_11910512 | 3300026334 | Soil | RNFSHLVMAQEYERMYHAVLETGTLPPGRPAPHLATAG |
Ga0209804_11390311 | 3300026335 | Soil | EACRAHAERNFSHLVMAQEYVRMYHTLLETGTLPPGRPAPHLATAG |
Ga0209159_11104342 | 3300026343 | Soil | LRGRLAEWDPHACRARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP |
Ga0209807_10214554 | 3300026530 | Soil | ACRAHAERYFTHLVMAEEYTRLYRRLLETGRLPPGRPAPHLATAG |
Ga0209807_11433871 | 3300026530 | Soil | FSHLVMTEEYLRMYRGLLETGRLPPGRPAGHLARTG |
Ga0209376_13801972 | 3300026540 | Soil | RSPEACRAHAERYFTHITMAEQYVSLYRNLLATGALGPGRPTPYTIM |
Ga0209805_11957342 | 3300026542 | Soil | CRALAEQRFTHVVMAEEYVRMYRSLLDTGKLAPGRPATAA |
Ga0209805_13444322 | 3300026542 | Soil | DPGACRAHAERFFTHLVMAGEYLRMYRHVLETGTLPAGRTTSFVAA |
Ga0209161_101198513 | 3300026548 | Soil | ACRARAERSFSHLVMTDEYIRMYRSVLETGTLPPGRPTP |
Ga0209283_100303891 | 3300027875 | Vadose Zone Soil | HTRDPHACRGRAERYFSHLAMAEEYVRMYRALLDTGNLPPGRPTAG |
Ga0209488_111498472 | 3300027903 | Vadose Zone Soil | RAHATRYFSHVVMAEEYVRVYRHLLAHGELPPGRPTPYTTT |
Ga0307477_104504532 | 3300031753 | Hardwood Forest Soil | HAERYFSHGVMAAAYVRMYVGLLEQGTLPAGCPTPWAPSAT |
Ga0214473_117707372 | 3300031949 | Soil | ACRAHAERYFTHRVMAEEYLRMYGAVIAAGTLPPGRPTPYTSS |
Ga0307471_1002204041 | 3300032180 | Hardwood Forest Soil | AEQYFSHVVMAEEYLRMYRSLLDTGSLPPGRVTPHAPSATSP |
Ga0335079_116518912 | 3300032783 | Soil | AHAERYFTHLVMAEEYLRVYRHLIETGSLPAGRPTPYTRV |
Ga0335071_105369111 | 3300032897 | Soil | KPEACRAHAERYFSHIVMAEAYVRMYRGLLEAGTLPAGIATPYAP |
Ga0326731_10060593 | 3300033502 | Peat Soil | AERYFSHLVMAEEYVRFYRGFLETGALPEGRRTAM |
Ga0314862_0159791_2_151 | 3300033803 | Peatland | IDPEACRARAERHFSHLAMATAYVRMYEQLRQTGTLPPGIPVPGSAAAS |
Ga0364928_0058957_719_856 | 3300033813 | Sediment | PEACRAHAERYFTHCAMAEEYIRVYRAVIETGALPAGRPTPYAKS |
⦗Top⦘ |