NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102905

Metagenome / Metatranscriptome Family F102905

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102905
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 48 residues
Representative Sequence MREHTHLPAMVGFVRKHVAQHFQANRPRPSPAVSAKLLDAAPTTAERF
Number of Associated Samples 93
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.04 %
% of genes near scaffold ends (potentially truncated) 95.05 %
% of genes from short scaffolds (< 2000 bps) 84.16 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.079 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.881 % of family members)
Environment Ontology (ENVO) Unclassified
(15.842 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.554 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.84%    β-sheet: 0.00%    Coil/Unstructured: 63.16%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF01663Phosphodiest 2.97
PF09972DUF2207 2.97
PF07238PilZ 1.98
PF00111Fer2 1.98
PF05163DinB 1.98
PF00248Aldo_ket_red 1.98
PF12704MacB_PCD 1.98
PF02687FtsX 1.98
PF00118Cpn60_TCP1 1.98
PF00069Pkinase 0.99
PF00437T2SSE 0.99
PF10282Lactonase 0.99
PF04715Anth_synt_I_N 0.99
PF01618MotA_ExbB 0.99
PF13533Biotin_lipoyl_2 0.99
PF01066CDP-OH_P_transf 0.99
PF03030H_PPase 0.99
PF13335Mg_chelatase_C 0.99
PF00296Bac_luciferase 0.99
PF12840HTH_20 0.99
PF04955HupE_UreJ 0.99
PF01266DAO 0.99
PF07593UnbV_ASPIC 0.99
PF00882Zn_dep_PLPC 0.99
PF14897EpsG 0.99
PF04977DivIC 0.99
PF01592NifU_N 0.99
PF09587PGA_cap 0.99
PF00392GntR 0.99
PF00756Esterase 0.99
PF04307YdjM 0.99
PF00092VWA 0.99
PF02837Glyco_hydro_2_N 0.99
PF12680SnoaL_2 0.99
PF00491Arginase 0.99
PF07859Abhydrolase_3 0.99
PF03544TonB_C 0.99
PF00270DEAD 0.99
PF04909Amidohydro_2 0.99
PF02073Peptidase_M29 0.99
PF01435Peptidase_M48 0.99
PF00230MIP 0.99
PF04191PEMT 0.99
PF00266Aminotran_5 0.99
PF00378ECH_1 0.99
PF13654AAA_32 0.99
PF13398Peptidase_M50B 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.96
COG0147Anthranilate/para-aminobenzoate synthases component IAmino acid transport and metabolism [E] 1.98
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 1.98
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 1.98
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.99
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.99
COG4839Cell division protein FtsLCell cycle control, cell division, chromosome partitioning [D] 0.99
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 0.99
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 0.99
COG2919Cell division protein FtsBCell cycle control, cell division, chromosome partitioning [D] 0.99
COG2370Hydrogenase/urease accessory protein HupEPosttranslational modification, protein turnover, chaperones [O] 0.99
COG2309Leucyl aminopeptidase (aminopeptidase T)Amino acid transport and metabolism [E] 0.99
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.99
COG1988Membrane-bound metal-dependent hydrolase YbcI, DUF457 familyGeneral function prediction only [R] 0.99
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.99
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 0.99
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.99
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.99
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.99
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.07 %
UnclassifiedrootN/A6.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100524451Not Available1062Open in IMG/M
3300002568|C688J35102_119376441All Organisms → cellular organisms → Eukaryota683Open in IMG/M
3300005327|Ga0070658_11617257All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300005337|Ga0070682_101750168All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300005435|Ga0070714_101135880All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium762Open in IMG/M
3300005436|Ga0070713_100338087All Organisms → cellular organisms → Bacteria → Acidobacteria1394Open in IMG/M
3300005436|Ga0070713_101813048All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300005450|Ga0066682_10370534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6921Open in IMG/M
3300005467|Ga0070706_100174792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2005Open in IMG/M
3300005536|Ga0070697_100506961All Organisms → cellular organisms → Bacteria → Acidobacteria1055Open in IMG/M
3300005542|Ga0070732_10220224All Organisms → cellular organisms → Bacteria → Acidobacteria1135Open in IMG/M
3300005558|Ga0066698_10523301All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300005921|Ga0070766_10730531All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300005994|Ga0066789_10318370All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300006031|Ga0066651_10211918All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1026Open in IMG/M
3300006034|Ga0066656_10135016All Organisms → cellular organisms → Bacteria1531Open in IMG/M
3300006797|Ga0066659_10023374All Organisms → cellular organisms → Bacteria3582Open in IMG/M
3300006800|Ga0066660_11391469All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300007265|Ga0099794_10092606All Organisms → cellular organisms → Bacteria1501Open in IMG/M
3300009088|Ga0099830_10247272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1410Open in IMG/M
3300009143|Ga0099792_10663442All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300012349|Ga0137387_11086675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300012927|Ga0137416_10638637All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300014151|Ga0181539_1175199All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus839Open in IMG/M
3300014154|Ga0134075_10569879All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300014201|Ga0181537_10651200All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300014501|Ga0182024_10012679All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae16628Open in IMG/M
3300014745|Ga0157377_10088859All Organisms → cellular organisms → Bacteria1820Open in IMG/M
3300015052|Ga0137411_1378842All Organisms → cellular organisms → Bacteria → Acidobacteria940Open in IMG/M
3300015053|Ga0137405_1430233All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → Candidatus Nitrospira nitrosa2927Open in IMG/M
3300015054|Ga0137420_1031051All Organisms → cellular organisms → Bacteria → Acidobacteria1755Open in IMG/M
3300017925|Ga0187856_1096386All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300017937|Ga0187809_10177797All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300017946|Ga0187879_10205376All Organisms → cellular organisms → Bacteria → Acidobacteria1104Open in IMG/M
3300017996|Ga0187891_1087479All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300018006|Ga0187804_10009265All Organisms → cellular organisms → Bacteria → Acidobacteria3330Open in IMG/M
3300018025|Ga0187885_10086600All Organisms → cellular organisms → Bacteria → Acidobacteria1540Open in IMG/M
3300018040|Ga0187862_10502900All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300018043|Ga0187887_10529508All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300020583|Ga0210401_10028898All Organisms → cellular organisms → Bacteria5285Open in IMG/M
3300021178|Ga0210408_10191899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1624Open in IMG/M
3300021178|Ga0210408_10851666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300021432|Ga0210384_10101402All Organisms → cellular organisms → Bacteria2582Open in IMG/M
3300021474|Ga0210390_10638532All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300021559|Ga0210409_10364546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1297Open in IMG/M
3300021559|Ga0210409_11410774All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300022717|Ga0242661_1031551All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300025960|Ga0207651_11348187All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300026313|Ga0209761_1167068All Organisms → cellular organisms → Bacteria → Acidobacteria1018Open in IMG/M
3300026325|Ga0209152_10005427All Organisms → cellular organisms → Bacteria4641Open in IMG/M
3300026328|Ga0209802_1040824All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2363Open in IMG/M
3300026343|Ga0209159_1051359All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300026355|Ga0257149_1027320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium795Open in IMG/M
3300027562|Ga0209735_1032117All Organisms → cellular organisms → Bacteria → Acidobacteria1102Open in IMG/M
3300027641|Ga0208827_1193774All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300027643|Ga0209076_1013367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2142Open in IMG/M
3300027667|Ga0209009_1130961All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300027667|Ga0209009_1158620All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300027671|Ga0209588_1028871All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300027825|Ga0209039_10365582All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300027842|Ga0209580_10572948Not Available560Open in IMG/M
3300027846|Ga0209180_10007774All Organisms → cellular organisms → Bacteria → Acidobacteria5476Open in IMG/M
3300027908|Ga0209006_10690054All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300028536|Ga0137415_10409284All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300028562|Ga0302151_10137596Not Available845Open in IMG/M
3300028565|Ga0302145_10114979All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300028745|Ga0302267_10261497Not Available746Open in IMG/M
3300028748|Ga0302156_10081514All Organisms → cellular organisms → Bacteria → Acidobacteria1674Open in IMG/M
3300028779|Ga0302266_10155486Not Available892Open in IMG/M
3300028906|Ga0308309_10229382All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300029955|Ga0311342_10654425All Organisms → cellular organisms → Bacteria → Acidobacteria839Open in IMG/M
3300030007|Ga0311338_11164435All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300030494|Ga0310037_10434363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300030503|Ga0311370_12129124All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300030520|Ga0311372_10657948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. dw_531477Open in IMG/M
3300030524|Ga0311357_10651356All Organisms → cellular organisms → Bacteria → Acidobacteria963Open in IMG/M
3300030524|Ga0311357_11213717All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300030593|Ga0210263_1086705All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300030646|Ga0302316_10132335Not Available1045Open in IMG/M
3300031057|Ga0170834_109340020All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300031234|Ga0302325_12237690All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300031236|Ga0302324_102136594All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300031239|Ga0265328_10367310All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300031241|Ga0265325_10450101All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300031718|Ga0307474_10650021All Organisms → cellular organisms → Bacteria → Acidobacteria832Open in IMG/M
3300031754|Ga0307475_10067233All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2732Open in IMG/M
3300031754|Ga0307475_10588076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae892Open in IMG/M
3300031754|Ga0307475_11129282Not Available612Open in IMG/M
3300031754|Ga0307475_11248827All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300031837|Ga0302315_10729137All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300032160|Ga0311301_10485698All Organisms → cellular organisms → Bacteria1840Open in IMG/M
3300032261|Ga0306920_103818640All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300032770|Ga0335085_10032472All Organisms → cellular organisms → Bacteria → Proteobacteria7257Open in IMG/M
3300032892|Ga0335081_10666179All Organisms → cellular organisms → Bacteria → Proteobacteria1269Open in IMG/M
3300032954|Ga0335083_10059653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3964Open in IMG/M
3300033412|Ga0310810_10177520All Organisms → cellular organisms → Bacteria2438Open in IMG/M
3300033433|Ga0326726_12118166All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300033826|Ga0334847_022500All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300033983|Ga0371488_0286528All Organisms → cellular organisms → Bacteria → Acidobacteria793Open in IMG/M
3300034125|Ga0370484_0036491All Organisms → cellular organisms → Bacteria → Acidobacteria1187Open in IMG/M
3300034191|Ga0373909_0198316All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae633Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.91%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.91%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.94%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.95%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.97%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.98%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.98%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.99%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.99%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.99%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.99%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.99%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028562Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030593Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE024SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033826Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034191Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.1EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10052445113300002245Forest SoilMREHADLAAMMGFVRKHVAEYFHAHRPRLSPAVSLKLFDAAATIAERFG
C688J35102_11937644113300002568SoilMREHTHLPAMMGFVRKHVAQHFQANRPRRSPAVSAKLLDAVPTAAERFSEHFRAASGAL
Ga0070658_1161725723300005327Corn RhizosphereMREHTHLSAMVGFVRNHVAQHLRANRPRLSPAVSVKLLDPTETIA
Ga0070682_10175016823300005337Corn RhizosphereMREQTHLSAMVGFVRNHVAQHLRANRPRLSPAVSVKLLDPTETIAERFRKHLRASGRARG
Ga0070714_10113588023300005435Agricultural SoilMREHAHLPAMVRFVRKHVAEHLQANRPRLSPSVSAKLLDAASTT
Ga0070713_10033808723300005436Corn, Switchgrass And Miscanthus RhizosphereMREHADLPAMVSFVGKHVAQHFRANRPRLTPTVPAKPLDPTIAFAQRFR*
Ga0070713_10181304813300005436Corn, Switchgrass And Miscanthus RhizosphereMGEHADLPAMVGFVSKHVAQHFRANRPGPSPAVSEKLLDTALTAERFSEHLPAA
Ga0066682_1037053423300005450SoilMREHTHLPAMVGLVRKHVAQHFRANGPRPSPAVSAKLLDAAPTTAERF
Ga0070706_10017479233300005467Corn, Switchgrass And Miscanthus RhizosphereMRKHTHLPAMVGFVRKHVAQHFQTNRPRPSPAVSAKLLDAAPTTAERFSEHLRAAS
Ga0070697_10050696113300005536Corn, Switchgrass And Miscanthus RhizosphereMREHTHLPAMVGFVRKHIAQHFQANRPRPSPAVSAKLLDAAPTTAERFSEHLRAAS
Ga0070732_1022022423300005542Surface SoilMREHTHLPAMVGFVRKHIAQHFHAYWPRPGPAVSAKLLDAVPTAERFREHLRAASRTL
Ga0066698_1052330113300005558SoilMRQHTDLPAMVGFVRKHVAQHFHANRPRPSPAVSAKLLDAAPTTAER
Ga0070766_1073053113300005921SoilMMGFVRNHVAKHFQANRPRPSPAVSEKLFDPAPAAAERFSEHLRAASGALGQ
Ga0066789_1031837023300005994SoilMREHTHLSAMVGFVRKHIAQHFRANRPRLSPAVSAKLLDAASTTVERFSEHLRAAGG
Ga0066651_1021191813300006031SoilMREHTHLPAMVGFVRKHVAQHFQANRPRPSPAVSAKLLDAAPTTAERFSEHLRA
Ga0066656_1013501633300006034SoilMREHTYLPAMMGFVRKHVAQHFHANWPRLSPAVSEKLLDAAPTTAERFSEHLRAASAALGQSR
Ga0066659_1002337473300006797SoilMREHTHLPAMVGFVRKPVAQHFHANRPRRSPAVSAKLLDAASTTAERFSEHL
Ga0066660_1139146913300006800SoilMMGFVRKHAAQHLLANGPGLSPAVSAKPLDAAPTAKRFSEHLLAAGGALRQSRTR
Ga0099794_1009260613300007265Vadose Zone SoilMREHTHLPAMVGFVRKHVAQHFHANRPRPAPAVSAKLLDAAPTTAERF
Ga0099830_1024727233300009088Vadose Zone SoilMREHAYLPAMVGFVRKHVAQHFQANRPRRSPAVSAKLLDAAP
Ga0099792_1066344213300009143Vadose Zone SoilMGEHEHLPAVVGFVSKHVAQHLRANRPGLSPAVSAKLLDAALTTAERFSEHLGAASGALG
Ga0137387_1108667523300012349Vadose Zone SoilMREHTHLPAMVGFVRKHVAEHLHANRPRLSPAVSAKLLDAAPTTA
Ga0137416_1063863723300012927Vadose Zone SoilMREHTHLPAMVGFVRKHVAQHFQANWPRPSPAVSAKLLDAAPT
Ga0181539_117519913300014151BogMREHAHLPAMVGFVREHVAEHLRADRPGPSPAVSQKL
Ga0134075_1056987913300014154Grasslands SoilMVGFVRKHVAQHFQAKRPRRSPAVSAKLLDAAPTTAERFS
Ga0181537_1065120023300014201BogMREHTHLPSMVSFVSKHVAQHLQANRPRWSPAVSAKLFDAALTTAERFSEHLRTESS
Ga0182024_10012679153300014501PermafrostMRKHAHLPAMVGFVSNHVAQHLHAGRPGLSPSVSQ
Ga0157377_1008885913300014745Miscanthus RhizosphereMREHTHLSAMVGFVRNHVAQHLRANRPRLSPAVSVKLLDPTETI
Ga0137411_137884213300015052Vadose Zone SoilMREHTHLPAMVGFVRKHVAQHLQANWPRPSPAVSAKLLDA
Ga0137405_143023353300015053Vadose Zone SoilMREHTHLPAMVGFMRNHVAQHFHADRPRPTPAVSAKLLDAATTTAERFSEHLPRS
Ga0137420_103105123300015054Vadose Zone SoilMREHTHLPAMVGFVRKHVAQHFQANWPRPSPAVSAKLLDAAPTTA
Ga0187856_109638613300017925PeatlandMREHTHLPAMMGFVRKHVAQHFQANRPRPSPAVSAKLLDAAPTT
Ga0187809_1017779723300017937Freshwater SedimentMREHTHLPAMVGLVSKHVAEHFRANRPRPTPAVSEKLLDATLTIAQRFSEHLRAASGALG
Ga0187879_1020537613300017946PeatlandMSEQTDLPAMVGFVGKHVAQHFHANRPGPAPAVSAKFVDAARAAAERFSEH
Ga0187891_108747913300017996PeatlandMREHTHLPAMMGFVRKHVAQHFQANRPRPSPAVSAKLLDAAPTTAERFSEH
Ga0187804_1000926553300018006Freshwater SedimentMREHTHLPAMVGFVRKHVAQHFQANRPRPSPAVSAKLLDAAPTIAERFSEHLRAASGA
Ga0187885_1008660033300018025PeatlandMREHAHLAAMVGFVGKHVAQHFHANWPRRTPAVPAKFRNAAAGIAECFSEHLHAA
Ga0187862_1050290013300018040PeatlandMREHTHLPAMVGFVRKHVAQHFQANRPRPSPAVSAELLDAARTTAERFS
Ga0187887_1052950823300018043PeatlandMREHAHLPTMVGFVSKHVAQHFRANWPRPTPAVSKKVLDAASTTAKRFTKHLGTASGAFGQT
Ga0210401_1002889843300020583SoilMREHKHLPAMVGFVRKHVAQHFRADRPRTSPAVSEEFLDAATTTAKRFSEHLRAASGTFG
Ga0210408_1019189933300021178SoilMREHTHLPAMVGFVSKHVAEHFRTNRPGPTPAVSEKLLDATLTIERFSEHLRAAG
Ga0210408_1085166613300021178SoilMREHAHLPAVVGFVSKHVAQHFRASRPRLSPTVSVKLFNAAPNA
Ga0210384_1010140243300021432SoilMRNHADLAAMVGFVGKHVAHHFQANRPRPGPAVSAKLLDAARTGAERFR
Ga0210390_1063853213300021474SoilMRQHTNLPAMVGFVSKHVAQHFHANRPRPSPAVSVKGLNPTTTAE
Ga0210409_1036454623300021559SoilMREHAHLPAMVRFMRNHVAQHFDASRPGLSPAVPEKLFDAAFTI
Ga0210409_1141077413300021559SoilMREHTHLAAMVGFVSKHVAQHFHANRPRLSPAVSKKLLDA
Ga0242661_103155123300022717SoilMRQHTHLSAMVGFVRKHVAQHFRANRPWPSPAVSEKLLDAAPTTAERFGEHIRAASG
Ga0207651_1134818723300025960Switchgrass RhizosphereMREHTHLPAMVSFVRKHVAQHFHANRPRRSPAVPVKLLDAA
Ga0209761_116706823300026313Grasslands SoilMVGFVRKHVAQHLRANRPRPSPPVSAKLLDAAPTTAERFSEHLLAAGGALGQSRTG
Ga0209152_1000542743300026325SoilMREHTHLPAMVGFVRKHVAQHFQANRPRPSPAISTKLLDASPTTAER
Ga0209802_104082413300026328SoilMREHTHLPAMVGFVRKHVAQHFQANRPRPSPAVSAKLLDAAPTTAERF
Ga0209159_105135913300026343SoilMREHTHLPAMVGFVRKHVAQHFQANRPRPSPAISAKLLDAATTTAERFSEHLRAASGALR
Ga0257149_102732013300026355SoilMREHTHLPAMVGFVRKHVAQHFRANRPRRSPAVSAKLLDAAPTTAE
Ga0209735_103211723300027562Forest SoilMREHTHLPAMVGFVRKHVTQHFRANGPRLSPAVSEKLLDSATTA
Ga0208827_119377423300027641Peatlands SoilMREHTHLPAMVGFVSKHVAEHFRANRPRATPAVSEK
Ga0209076_101336753300027643Vadose Zone SoilMREHTHLPAMVGFVRKHVAQHFQANRPRPSPAVSAKLLDA
Ga0209009_113096123300027667Forest SoilMRQHTHLPAMVGFMSKHVAQHFQANRPRPSPAVPEKLLDAAPT
Ga0209009_115862023300027667Forest SoilMSEHTHLAAMVGFMRKHVAQHFYTGRPRLCPAVSVKLFDAASTTAQR
Ga0209588_102887123300027671Vadose Zone SoilMREHTHLPAMVGFVRKHVTQHFDANRPGPSPAVSVKLLDAALTTAERF
Ga0209039_1036558213300027825Bog Forest SoilMREHTHLPAMVSFVGKHVTQHFRANRPSWGPSVSAKLLDAASRTAERFG
Ga0209580_1057294813300027842Surface SoilMREHTHLPAMVGFVRKHIAQHFHAYWPRPGPAVSAKLLDA
Ga0209180_1000777473300027846Vadose Zone SoilMREHTHLPAMVGFVRKHVAQHFHANRPRPAPAVSAELLDAGPATA
Ga0209006_1069005433300027908Forest SoilMGKHAHLPAMVSFVRKHVAQHFHANRPRPSPAVPAKLLDAATTIAERFSEHLGAASGAF
Ga0137415_1040928413300028536Vadose Zone SoilMREHAHLPAVVGFVRKHVAQHFHANRPRPAPAVSAKLLDAASTTAERFSEHLRAAS
Ga0302151_1013759623300028562BogMREHAHLPAVVGFVRNHVAEHLWANRPGLSPAISQKLLDAAPAAAERFSQ
Ga0302145_1011497923300028565BogMRQHASLPAMVGFVGDHVAQHLRANRPGLSPAISQKHFDASA
Ga0302267_1026149713300028745BogMREHAHLPAVVGFVRNHVAEHLWANRPGLSPAISQKLLDAA
Ga0302156_1008151443300028748BogMREHGNLPAMVGFVSNHIAQHLGADRPGLSPAVSQESREA
Ga0302266_1015548613300028779BogMREHAHLPAVVGFVRNHVAEHLWANRPGLSPAISQKLLD
Ga0308309_1022938233300028906SoilMREHTHLPAMVGFVRNHVAKHFQANRPRPSPAVSEKLFDAAPAAAERFSEHLRAAS
Ga0311342_1065442513300029955BogLMREQAHLPAMMGFMRKHVAQHFRPNGPRLRPAVPIKLFNS
Ga0311338_1116443513300030007PalsaMRKHANLPAMMGFVRNHVAQHFHPRRPGRAPAVTAKLLDATSTPERLCEHLRAARCALSQSGTGLLR
Ga0310037_1043436313300030494Peatlands SoilMREHTHLPAMVGFVSKHVAEHFRANRPRATPAVSEKLLDATPTIAE
Ga0311370_1212912423300030503PalsaMREHTHLPAMVGFVRKHVAQHFRANRPRPSPAVSAKLLDAAPTT
Ga0311372_1065794813300030520PalsaMRQHTHLPAMVGFVSNHIAQHFQARRPRPSPAVPVKLLD
Ga0311357_1065135613300030524PalsaMREHAHLSAMVGFVRKHVAEHFQADRHWPSPAVAAKIFNATAIVAERLIEH
Ga0311357_1121371723300030524PalsaMREHADLTAMVSFVSKHVAEHFYAYRPRPRPAVAVKI
Ga0210263_108670513300030593SoilMPEHTHLPAMVSFVRKHVAQHFNPNRPRPSPAVSAKLLDAAPTI
Ga0302316_1013233523300030646PalsaVRQHAHLAAMVGFVSNHVAEHLRANRPGLSPAVSHEVL
Ga0170834_10934002023300031057Forest SoilMCEHAHLPPMVRFVRKHVAEHFQANRHRPMPAVAAKIFDATT
Ga0302325_1223769023300031234PalsaMREHAHLSAMVGFVRKHVAEHFQANRHWPSPAVAAKLFNAAAIVAERLIEHLHAA
Ga0302324_10213659423300031236PalsaMREHRHLPAMVGFVGEHVTQHFYANRPRLTPAVSAKLLDAATATAECLSE
Ga0265328_1036731023300031239RhizosphereMREHEHLSAMVSFVRKHVAKHFHSNRPRPCPTVSVKFCDA
Ga0265325_1045010113300031241RhizosphereMGEHTHLPAMVGFVSNHVAQHFRANRPRPSPAVSAKLGDAAATTAERFGE
Ga0307474_1065002133300031718Hardwood Forest SoilMREHTHLPAMVSFVRKHVAQHFRANRPRLTPAISAKLL
Ga0307475_1006723313300031754Hardwood Forest SoilMREHAHLPAMVGFVGKHVAQHLDANWPRPGPSVSAKLLDAAFSTV
Ga0307475_1058807613300031754Hardwood Forest SoilMREHEHLSAMVGFVSKHVAEHLRANRPRQSPAVSAK
Ga0307475_1112928213300031754Hardwood Forest SoilMVRQPKSELMREHAHLPAMVSFVSQHVAQHFRADWPRLGPAVSAELPDAAPATERF
Ga0307475_1124882723300031754Hardwood Forest SoilLMREHADLSAMVSFVSKHVAQHFHANRPGPSPAVSQEVLDAAFVP
Ga0302315_1072913723300031837PalsaMREHAHLSAMVGFVRKHVAEHFQADRHWPSPAVAAKIFNATAIVAERLIEHLHAASGALSQCRTGL
Ga0311301_1048569823300032160Peatlands SoilMGEHTYLPAMVGFVGNHVAQHFHAGRPGPAPAVAVKFLDAA
Ga0306920_10381864013300032261SoilMREHAHLPAMVSFVRDHVTKHFYANRPGLTPAVATKFLDATA
Ga0335085_1003247273300032770SoilMREHEYLPAMVGFMRKHVAQHFGTHRPRLSPAVSAKLLDAAPTTAECFS
Ga0335081_1066617913300032892SoilMRQHAHLPAMVRFVRKHVAQHFRADWPRPSPAISAKFLDAGSRTAEGFGEHFCAAS
Ga0335083_1005965313300032954SoilMREHEYLPAMVGFMRKHVAQHFGTHRPSLSPAVSAKLLDAAPTTAECFS
Ga0310810_1017752033300033412SoilMREHTHLPAMVSFVRKHVTQHLRAGGPSPSPAVSTELLHAAAR
Ga0326726_1211816613300033433Peat SoilMRKHVAQHFRANRPRRSPAVSAKLLDAASSTAERFREHLRAASGALGQSRTGLRTWQNSKDG
Ga0334847_022500_3_1793300033826SoilMREHTHLPAMVGFVRKHVAEHFRPSGPGPSPAVPVKLRDASTTAERFREHLFAASGALG
Ga0371488_0286528_664_7923300033983Peat SoilMREHTHLPAMVGFVRKHVAQHFHANRPRPSPAVSAKFLDAARA
Ga0370484_0036491_993_11753300034125Untreated Peat SoilMREHAHLPAMVGFVRKHVAQHFQANRPRPSPTVSAKLLDAAPTIAERFREHLRAASGALG
Ga0373909_0198316_486_6323300034191Sediment SlurryMREHTHLPAMVGFVRKHVAQHFQANRPRLSPAVSAKLFDAAPTTAERFS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.