Basic Information | |
---|---|
Family ID | F102875 |
Family Type | Metagenome |
Number of Sequences | 101 |
Average Sequence Length | 45 residues |
Representative Sequence | LESSYEEALEFESYLQEAQAASPEFAEGVQAFLARRAKK |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.02 % |
% of genes from short scaffolds (< 2000 bps) | 82.18 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.188 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (28.713 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.584 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.356 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF00108 | Thiolase_N | 58.42 |
PF02803 | Thiolase_C | 23.76 |
PF00440 | TetR_N | 3.96 |
PF01209 | Ubie_methyltran | 3.96 |
PF00348 | polyprenyl_synt | 1.98 |
PF01850 | PIN | 1.98 |
PF04964 | Flp_Fap | 0.99 |
PF10531 | SLBB | 0.99 |
PF14559 | TPR_19 | 0.99 |
PF00378 | ECH_1 | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 82.18 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 3.96 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 3.96 |
COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 1.98 |
COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.19 % |
Unclassified | root | N/A | 18.81 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000880|AL20A1W_1220087 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300001536|A1565W1_10582380 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300001536|A1565W1_10871859 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
3300002028|A17_1001803 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300005179|Ga0066684_10009474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4640 | Open in IMG/M |
3300005179|Ga0066684_10739183 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300005184|Ga0066671_10229175 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300005468|Ga0070707_100646132 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300005540|Ga0066697_10074996 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
3300005540|Ga0066697_10653561 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005546|Ga0070696_100706717 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300005547|Ga0070693_101360537 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005553|Ga0066695_10061707 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
3300005554|Ga0066661_10348930 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300005554|Ga0066661_10776897 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300005555|Ga0066692_11034947 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005556|Ga0066707_10943480 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005558|Ga0066698_10239124 | Not Available | 1251 | Open in IMG/M |
3300005568|Ga0066703_10171525 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300005575|Ga0066702_10446819 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300005575|Ga0066702_10877355 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005576|Ga0066708_10008991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4589 | Open in IMG/M |
3300005576|Ga0066708_10035686 | All Organisms → cellular organisms → Bacteria | 2691 | Open in IMG/M |
3300005598|Ga0066706_10250927 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300006800|Ga0066660_10419239 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
3300006804|Ga0079221_11090651 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300006806|Ga0079220_10178487 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300006854|Ga0075425_101715232 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300006864|Ga0066797_1051134 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300006914|Ga0075436_100621967 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300007265|Ga0099794_10477847 | Not Available | 655 | Open in IMG/M |
3300009088|Ga0099830_11157490 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300009089|Ga0099828_10011954 | All Organisms → cellular organisms → Bacteria | 6509 | Open in IMG/M |
3300009089|Ga0099828_10040062 | All Organisms → cellular organisms → Bacteria | 3832 | Open in IMG/M |
3300009089|Ga0099828_10892473 | Not Available | 794 | Open in IMG/M |
3300009090|Ga0099827_10181105 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300010301|Ga0134070_10269785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 641 | Open in IMG/M |
3300010326|Ga0134065_10230052 | Not Available | 683 | Open in IMG/M |
3300010335|Ga0134063_10168045 | Not Available | 1023 | Open in IMG/M |
3300010336|Ga0134071_10020984 | All Organisms → cellular organisms → Bacteria | 2767 | Open in IMG/M |
3300010358|Ga0126370_11507557 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300010361|Ga0126378_12156640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300010400|Ga0134122_11015575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 814 | Open in IMG/M |
3300011269|Ga0137392_10025075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4250 | Open in IMG/M |
3300011270|Ga0137391_11134559 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300011270|Ga0137391_11286302 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300011271|Ga0137393_10454293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1098 | Open in IMG/M |
3300011271|Ga0137393_10759121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
3300011998|Ga0120114_1010942 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300011998|Ga0120114_1023661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1269 | Open in IMG/M |
3300011999|Ga0120148_1044995 | Not Available | 909 | Open in IMG/M |
3300012096|Ga0137389_11755822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 516 | Open in IMG/M |
3300012189|Ga0137388_11363721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
3300012199|Ga0137383_10159480 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
3300012208|Ga0137376_10071220 | All Organisms → cellular organisms → Bacteria | 2893 | Open in IMG/M |
3300012208|Ga0137376_10391236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1207 | Open in IMG/M |
3300012209|Ga0137379_11287745 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300012351|Ga0137386_10371685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium pseudokansasii | 1029 | Open in IMG/M |
3300012359|Ga0137385_10020263 | All Organisms → cellular organisms → Bacteria | 5942 | Open in IMG/M |
3300012359|Ga0137385_11117146 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012363|Ga0137390_12012282 | Not Available | 503 | Open in IMG/M |
3300012917|Ga0137395_10163739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1530 | Open in IMG/M |
3300012918|Ga0137396_10282133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1227 | Open in IMG/M |
3300012927|Ga0137416_11592057 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300013503|Ga0120127_10157880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
3300013764|Ga0120111_1042306 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300013772|Ga0120158_10075515 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
3300015358|Ga0134089_10227084 | Not Available | 757 | Open in IMG/M |
3300015373|Ga0132257_104190511 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300017654|Ga0134069_1089503 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300018433|Ga0066667_11153497 | Not Available | 672 | Open in IMG/M |
3300018468|Ga0066662_12910767 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300018482|Ga0066669_10010359 | All Organisms → cellular organisms → Bacteria | 4715 | Open in IMG/M |
3300021046|Ga0215015_10420603 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300022691|Ga0248483_164366 | All Organisms → cellular organisms → Bacteria | 2852 | Open in IMG/M |
3300025910|Ga0207684_10502473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1039 | Open in IMG/M |
3300025913|Ga0207695_11010701 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300026298|Ga0209236_1014833 | All Organisms → cellular organisms → Bacteria | 4493 | Open in IMG/M |
3300026298|Ga0209236_1203321 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300026309|Ga0209055_1201154 | Not Available | 609 | Open in IMG/M |
3300026313|Ga0209761_1344284 | Not Available | 505 | Open in IMG/M |
3300026324|Ga0209470_1077451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1530 | Open in IMG/M |
3300026333|Ga0209158_1228739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 640 | Open in IMG/M |
3300026335|Ga0209804_1220551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium freirei → Rhizobium freirei PRF 81 | 759 | Open in IMG/M |
3300026343|Ga0209159_1036669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2548 | Open in IMG/M |
3300026527|Ga0209059_1060755 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
3300026529|Ga0209806_1161777 | Not Available | 840 | Open in IMG/M |
3300026530|Ga0209807_1003691 | All Organisms → cellular organisms → Bacteria | 7517 | Open in IMG/M |
3300026530|Ga0209807_1138210 | Not Available | 954 | Open in IMG/M |
3300026537|Ga0209157_1052802 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
3300026538|Ga0209056_10162507 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
3300026551|Ga0209648_10406676 | Not Available | 887 | Open in IMG/M |
3300027587|Ga0209220_1035094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1344 | Open in IMG/M |
3300027643|Ga0209076_1125042 | Not Available | 726 | Open in IMG/M |
3300027738|Ga0208989_10137027 | Not Available | 825 | Open in IMG/M |
3300027910|Ga0209583_10203481 | Not Available | 847 | Open in IMG/M |
3300028047|Ga0209526_10624062 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300028536|Ga0137415_10324460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1343 | Open in IMG/M |
3300028819|Ga0307296_10749301 | Not Available | 533 | Open in IMG/M |
3300031754|Ga0307475_11580041 | Not Available | 501 | Open in IMG/M |
3300032160|Ga0311301_11767246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 739 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 28.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.74% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 8.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.96% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.98% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.99% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.99% |
Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.99% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300002028 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_A17 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300022691 | Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AL20A1W_12200872 | 3300000880 | Permafrost | PRGALAGAKRSVVHALESTYEEALEFESYLQEAQAASPEFSEGVRTFLAKRAKK* |
A1565W1_105823803 | 3300001536 | Permafrost | VHALESTYEEALEFESYLQEAQAASPEFSEGVRTFLAKRAKK* |
A1565W1_108718592 | 3300001536 | Permafrost | LVHALESSYEEALEFESYLQEAQAASSEFTEGVSAFLAKRAKK* |
A17_10018032 | 3300002028 | Permafrost And Active Layer Soil | HALESSYEEALEFESYLQEAQAASPEFAEGVAAFLARGAKK* |
Ga0066684_100094747 | 3300005179 | Soil | AAAKRAVNHALDSTFEQALEFESYLQEAQAASPEFAEGVASFLARRASKK* |
Ga0066684_107391831 | 3300005179 | Soil | MAGAKRAVNHALTSTYEEAMEFESYLQEAQAGSPEFAEGVRSFLARRAVKK* |
Ga0066671_102291752 | 3300005184 | Soil | AIAAAKRAVNHALDSTFEQALEFESYLQEAQAASPEFAEGVANFLARRASRK* |
Ga0070707_1006461321 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AAKRAVNHALESSYEEALEFESYLQEAQAWSPEFAEGVQKFLARRSKK* |
Ga0066697_100749961 | 3300005540 | Soil | SQPRQAVAAAKRAVIHALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRKRN* |
Ga0066697_106535612 | 3300005540 | Soil | SSYEGALEFESYLQEAQAGSQEFADGVQAFLARRKK* |
Ga0070696_1007067172 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LESSYEEALEFESYLQEAQAASPEFAEGVSAFLAKRSKK* |
Ga0070693_1013605372 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | NHALTSSYEDAMEFESYLQEAQAGSAEFAEGVQAFLARRASKK* |
Ga0066695_100617074 | 3300005553 | Soil | AGAKRAVNHALTSTYEEAMEFESYLQEAQAGSSEFAEGVQKFLESRRKK* |
Ga0066661_103489302 | 3300005554 | Soil | AGAKRAVNHALNSTFEEAMEFESYLQEAQAASPEFAEGVQRFLESRKKK* |
Ga0066661_107768972 | 3300005554 | Soil | GALAAAKRAVNHALDSTFEQALEFESYLQEAQAASPEFAEGVANFLARRASRK* |
Ga0066692_110349471 | 3300005555 | Soil | TFEQALEFESYLQEAQAASAEFAEGVQAFLSRRSAKQG* |
Ga0066707_109434801 | 3300005556 | Soil | NHALESSYEGALEFESYLQEAQAGSQEFADGVQAFLARRKK* |
Ga0066698_102391241 | 3300005558 | Soil | YEEAMEFESYLQEAQAASPEFAEGVRNFLARRAAKKK* |
Ga0066703_101715252 | 3300005568 | Soil | STYEEAMEFESYLQEAQAASPEFAEGVQNFLARRATKK* |
Ga0066702_104468191 | 3300005575 | Soil | AAAKRAVNHALESSFEDALEFESYLQESQAASPEFAEGVQAFLARRSKK* |
Ga0066702_108773551 | 3300005575 | Soil | ANQLAAQPRQAMAGAKRAVIHALESSYEEALVFESYLQEAQAASSEFAEGVQSFLARRAAKQS* |
Ga0066708_100089917 | 3300005576 | Soil | AAAKRAVNHALDSTFEQALEFESYLQEAQAASPEFAEGVANFLARRASRK* |
Ga0066708_100356864 | 3300005576 | Soil | AKRAVNHALESSYEGALEFESYLQEAQAGSQEFADGVQAFLARRKK* |
Ga0066706_102509272 | 3300005598 | Soil | GAKRAVLHALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRAAKK* |
Ga0066660_104192391 | 3300006800 | Soil | LAAQPRGALAGAKRAVTHALESTFEQALEFESYLQEAQAASPEFAEGVQNFLARRAAKQT |
Ga0079221_110906512 | 3300006804 | Agricultural Soil | LNSTFEEAMEFESYLQEAQAASPEFVEGVQNFLARRASKK* |
Ga0079220_101784872 | 3300006806 | Agricultural Soil | AKRAVNHALTSSFEDAMEFESYLQEAQAGSSEFAEGVQNFLARRASKK* |
Ga0075425_1017152321 | 3300006854 | Populus Rhizosphere | TSTYEEAMEFESYLQEAQAGSSEFAEGVQKFLQSRSKK* |
Ga0066797_10511342 | 3300006864 | Soil | LESSFEEALEFESYLQEAQAASPEFAEGVSAFLAKRTKK* |
Ga0075436_1006219672 | 3300006914 | Populus Rhizosphere | VNHALGSSYEEAMEFESYLQEAQAGSSEFAEGVQNFLARRAARK* |
Ga0099794_104778471 | 3300007265 | Vadose Zone Soil | IHALESSYEEALEFESYLQEAQSASPEFAEGVAAFLAKRGKK* |
Ga0099830_111574902 | 3300009088 | Vadose Zone Soil | AAAKRAVNHALESSYEEALEFESYLQEAQAWSPEFAEGVQKFLARRSKK* |
Ga0099828_1001195410 | 3300009089 | Vadose Zone Soil | AVNHALESSYEEALEFESYLQEAQAASPEFAEGVQAFLARRAKRP* |
Ga0099828_100400626 | 3300009089 | Vadose Zone Soil | ESSYEGALEFESYLQEAQAATPEFAEMVQAFLARRAAKK* |
Ga0099828_108924731 | 3300009089 | Vadose Zone Soil | KRAVNHALESSYEEALEFESYLQEAQAWSPEFAEGVQKFLARRSEK* |
Ga0099827_101811053 | 3300009090 | Vadose Zone Soil | MAAAKRAVNHALESSYEEALEFESYLQEAQAWSPEFAEGVQKFLARRKKS* |
Ga0134070_102697851 | 3300010301 | Grasslands Soil | LAAAKRAVNHALESSYEDALEFESYLQEAQAGTSEFAELVQAFLARRAAKK* |
Ga0134065_102300521 | 3300010326 | Grasslands Soil | RAVNHALESSYEGALEFESYLQEAQAGSQEFADGVQAFLARRKK* |
Ga0134063_101680451 | 3300010335 | Grasslands Soil | LTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRAKK* |
Ga0134071_100209841 | 3300010336 | Grasslands Soil | KRAVNHALTSTYEEAMEFESYLQEAQAGSSEFAEGVQKFLESRSKK* |
Ga0126370_115075571 | 3300010358 | Tropical Forest Soil | NSTFEEAMEFESYLQEAQAGSTEFVEGVQNFLARRAAKQ* |
Ga0126378_121566402 | 3300010361 | Tropical Forest Soil | VNHALSSTFEEAMEFESYLQEAQVGSAEFAEGVQNFLARRSAKK* |
Ga0134122_110155751 | 3300010400 | Terrestrial Soil | VNHALTSTYEEAMEFESYLQEAQAGSSEFAEGVQNFLARRAKK* |
Ga0137392_100250756 | 3300011269 | Vadose Zone Soil | EGALEFESYLQEAQAATPEFAEMVQAFLARRAAKK* |
Ga0137391_111345591 | 3300011270 | Vadose Zone Soil | AKRAVNHALESSYEEALEFESYLQEAQAWSPEFAEGVQKFLARRSKK* |
Ga0137391_112863021 | 3300011270 | Vadose Zone Soil | RAVNHALESSYEEALEFESYLQEAQAASPEFAEGVAAFLARRSKKQ* |
Ga0137393_104542932 | 3300011271 | Vadose Zone Soil | AAAKRAVNQALESNFEEALEFESYLQEGQAWSPEFAEGVQKFLARRTQK* |
Ga0137393_107591211 | 3300011271 | Vadose Zone Soil | TFEQALEFESYLQEAQAASPEFAEGVQNFLARRAAKK* |
Ga0120114_10109423 | 3300011998 | Permafrost | LESSYEEALEFESYLQEAQAASPEFAEGVQAFLARRAKK* |
Ga0120114_10236612 | 3300011998 | Permafrost | NHALESSYEEALEFESYLQEAQAASQEFVDGVQAFLARRAKK* |
Ga0120148_10449951 | 3300011999 | Permafrost | VTHALESSYEEALEFESYLQEAQAASPEFAEGVQAFLAKRSKK* |
Ga0137389_117558222 | 3300012096 | Vadose Zone Soil | EQAMEFESYLQEAQVATPEFAEGVQAFLARRAAKQK* |
Ga0137388_113637211 | 3300012189 | Vadose Zone Soil | LAAQPRGAMAGAKRAVNHALESTFEQALEFESYLQEAQAASPEFAEGVQNFLARRAAKK* |
Ga0137383_101594803 | 3300012199 | Vadose Zone Soil | EEALEFESYLQEAQAGSQEFRDGVSAFLAKRSKK* |
Ga0137376_100712205 | 3300012208 | Vadose Zone Soil | HALESSYEGALEFESYLQEAQAGSQEFADGVQAFLARRKK* |
Ga0137376_103912361 | 3300012208 | Vadose Zone Soil | AQPRQAMAGAKRAVNHALTSSFEEAMEFESYLQEAQAGSSEFAEGVQNFLARRKK* |
Ga0137379_112877452 | 3300012209 | Vadose Zone Soil | EEALEFESYLQEVQAGSQEFADGVQAFLARRAKK* |
Ga0137386_103716851 | 3300012351 | Vadose Zone Soil | LESSYEDALEFQSYLQEAQAASPEFAEGVANFLARRSQK* |
Ga0137385_100202631 | 3300012359 | Vadose Zone Soil | AVNHALVSSYEDAMEFESYLQEAQAASSEIAEGVQKVHARRSSSKK* |
Ga0137385_111171461 | 3300012359 | Vadose Zone Soil | QALAAAKRAVNHALESSYEDALEFESYLQEAQAGTSEFAELVQAFLARRAAKK* |
Ga0137390_120122822 | 3300012363 | Vadose Zone Soil | AGQLAKQPRQALAAAKRAVNHALESSYEGALEFESYLQEAQAATPEFAEMVQAFLARRAAKK* |
Ga0137395_101637392 | 3300012917 | Vadose Zone Soil | RQALAAAKRAVNHALESSYEDALEFESYLQEAQAATPEFAEMVQAFLARRAAKK* |
Ga0137396_102821332 | 3300012918 | Vadose Zone Soil | PRQAVAGAKRAVLHALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRAAKK* |
Ga0137416_115920572 | 3300012927 | Vadose Zone Soil | VVHALQSSFEEALEFESYLQEAQAASPEFADGVQAFLARRNKKK* |
Ga0120127_101578802 | 3300013503 | Permafrost | EEALEFESYLQEAQAGSQEFADGVQAFMARRAKK* |
Ga0120111_10423062 | 3300013764 | Permafrost | YEEALEFESYLQEAQAASQEFVDGVQAFLARRAKK* |
Ga0120158_100755154 | 3300013772 | Permafrost | HALESSYEEALEFESYLQEAQAASQEFVDGVQAFLARRAKK* |
Ga0134089_102270841 | 3300015358 | Grasslands Soil | VNHALTSTYEEAMEFESYLQEAQAGSSEFAEGVQKFLESRSKK* |
Ga0132257_1041905111 | 3300015373 | Arabidopsis Rhizosphere | NHLVSQPRQALAGAKRAVNHALTSSFEDAMEFESYLQEAQAGSAEFAEGVQNFLARRASKK* |
Ga0134069_10895032 | 3300017654 | Grasslands Soil | ESSYEGALEFESYLQEAQAGSQEFADGVQAFLARRKK |
Ga0066667_111534972 | 3300018433 | Grasslands Soil | PRQAVAAAKRAVIHALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRKRN |
Ga0066662_129107671 | 3300018468 | Grasslands Soil | ESSFEEALEFESYLQEAQVASPEFVEGVQAFLARRSKKP |
Ga0066669_100103598 | 3300018482 | Grasslands Soil | QLGAQPRQAVAGAQRAGLHALSSTYGEAMEFESYLQEAQAASPEFAEGVQNFLARRAKK |
Ga0215015_104206031 | 3300021046 | Soil | GAKRARVHALDSSFEQAMEFESYLQEAQAASPEFAEGVQAFLSKRARK |
Ga0248483_1643664 | 3300022691 | Soil | YEEALEFESYLQEAQAASPEFAEGVAAFLAKRAKR |
Ga0207684_105024732 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EDALEFESYLQEAQAASPEFAEGVQAFLARRAQKK |
Ga0207695_110107012 | 3300025913 | Corn Rhizosphere | SQPPNAMASAKRAVNNALNSTYDEAMEFESYLQEAQAGSQEFVDGVQAFIARRAKK |
Ga0209236_10148331 | 3300026298 | Grasslands Soil | ALESSFEEALEFESYLQEAQVASPEFAEGVQAFLARRSKKP |
Ga0209236_12033212 | 3300026298 | Grasslands Soil | STYEEAMEFESYLQEAQAASPEFAEGVQNFLARRAAKK |
Ga0209055_12011542 | 3300026309 | Soil | LHALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRKRN |
Ga0209761_13442841 | 3300026313 | Grasslands Soil | YEEAMEFESYLQEAQAASPEFAEGVQNFLARRAAKK |
Ga0209470_10774511 | 3300026324 | Soil | ALAAAKRAVNHALESSYEGALEFESYLQEAQAGSQEFADGVQAFLARRKK |
Ga0209158_12287392 | 3300026333 | Soil | SSFEEALEFESYLQEAQAASPEFAEGVQAFLARRKKS |
Ga0209804_12205512 | 3300026335 | Soil | VLHALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRKRD |
Ga0209159_10366691 | 3300026343 | Soil | VSSYEDAMEFESYLQEAQAASSEFAEGVQNFLARRSTKK |
Ga0209059_10607553 | 3300026527 | Soil | HALESTFEQALEFESYLQEAQAASPEFAEGVQAFLARRAAKK |
Ga0209806_11617771 | 3300026529 | Soil | ALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRATKK |
Ga0209807_100369111 | 3300026530 | Soil | QPRQAVAAAKRAVIHALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRAKK |
Ga0209807_11382101 | 3300026530 | Soil | QPRQAVAAAKRAVIHALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRAAKK |
Ga0209157_10528022 | 3300026537 | Soil | VNHALESSYEDALEFESYLQEAQAGTSEFAELVQAFLARRAAKK |
Ga0209056_101625073 | 3300026538 | Soil | AGAKRAVLHALTSTYEEAMEFESYLQEAQAASPEFAEGVQNFLARRAAKK |
Ga0209648_104066761 | 3300026551 | Grasslands Soil | NHALESSYEEALEFESYLQEAQAWSPEFAEGVQKFLARRSKK |
Ga0209220_10350942 | 3300027587 | Forest Soil | VHALESSYEEALEFESYLQEAQAASPEFREGVSAFLAKRGKR |
Ga0209076_11250421 | 3300027643 | Vadose Zone Soil | MAAAKRAVNHALESSFEEALEFESYLQESQAWSPEFAEGVQAFLARRTKK |
Ga0208989_101370272 | 3300027738 | Forest Soil | SFEEALEFESYLQEAQAASPEFADGVQAFLARRNKKK |
Ga0209583_102034812 | 3300027910 | Watersheds | VNHALESSYEEALEFESYLQEAQAASQEFVDGVQAFMARRAKK |
Ga0209526_106240622 | 3300028047 | Forest Soil | SYEEALEFESYLQEAQAASPEFAEGVQAFLAKRVKK |
Ga0137415_103244602 | 3300028536 | Vadose Zone Soil | SSFEEALEFESYLQEAQAASPEFAEGVQAFLARRKK |
Ga0307296_107493011 | 3300028819 | Soil | ALESSYEEALEFESYLQEAQAASPEFVEGVQAFLAKRSKK |
Ga0307475_115800411 | 3300031754 | Hardwood Forest Soil | HALESNYEEALEFESYLQEAQAASPEFIEGVQNFMARRASKK |
Ga0311301_117672461 | 3300032160 | Peatlands Soil | VTHALEASFEEALEFESYLQEAQAASAEFAEGVQAFLARRSARK |
⦗Top⦘ |