| Basic Information | |
|---|---|
| Family ID | F102863 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 48 residues |
| Representative Sequence | ITKEGVPTDSPISAERRALQKEQLMQHINELQVKVRLLEEREKMGKK |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 6.93 % |
| % of genes near scaffold ends (potentially truncated) | 90.10 % |
| % of genes from short scaffolds (< 2000 bps) | 91.09 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.525 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (29.703 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.396 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.446 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.67% β-sheet: 0.00% Coil/Unstructured: 53.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00959 | Phage_lysozyme | 15.84 |
| PF13539 | Peptidase_M15_4 | 4.95 |
| PF11351 | GTA_holin_3TM | 2.97 |
| PF00109 | ketoacyl-synt | 0.99 |
| PF13884 | Peptidase_S74 | 0.99 |
| PF13392 | HNH_3 | 0.99 |
| PF12705 | PDDEXK_1 | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.48 % |
| Unclassified | root | N/A | 47.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001837|RCM39_1068640 | Not Available | 592 | Open in IMG/M |
| 3300001851|RCM31_10144263 | Not Available | 586 | Open in IMG/M |
| 3300002835|B570J40625_101418210 | Not Available | 572 | Open in IMG/M |
| 3300003412|JGI25912J50252_10148072 | Not Available | 540 | Open in IMG/M |
| 3300005584|Ga0049082_10051626 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300006802|Ga0070749_10008242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6797 | Open in IMG/M |
| 3300006802|Ga0070749_10354181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 815 | Open in IMG/M |
| 3300006805|Ga0075464_10522487 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300007276|Ga0070747_1255113 | Not Available | 608 | Open in IMG/M |
| 3300008262|Ga0114337_1002070 | Not Available | 37269 | Open in IMG/M |
| 3300008266|Ga0114363_1132838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 848 | Open in IMG/M |
| 3300008450|Ga0114880_1202945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 663 | Open in IMG/M |
| 3300009152|Ga0114980_10300316 | Not Available | 932 | Open in IMG/M |
| 3300009155|Ga0114968_10515562 | Not Available | 640 | Open in IMG/M |
| 3300010354|Ga0129333_10062100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 3482 | Open in IMG/M |
| 3300010354|Ga0129333_10465536 | Not Available | 1112 | Open in IMG/M |
| 3300010354|Ga0129333_10550600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 1006 | Open in IMG/M |
| 3300010354|Ga0129333_10902494 | Not Available | 747 | Open in IMG/M |
| 3300010354|Ga0129333_11117558 | Not Available | 657 | Open in IMG/M |
| 3300010354|Ga0129333_11332258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 592 | Open in IMG/M |
| 3300010354|Ga0129333_11626256 | Not Available | 527 | Open in IMG/M |
| 3300010885|Ga0133913_10046026 | Not Available | 11731 | Open in IMG/M |
| 3300010885|Ga0133913_11009068 | Not Available | 2151 | Open in IMG/M |
| 3300012013|Ga0153805_1013390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
| 3300012663|Ga0157203_1051130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300012666|Ga0157498_1074277 | Not Available | 524 | Open in IMG/M |
| 3300013006|Ga0164294_10958474 | Not Available | 575 | Open in IMG/M |
| 3300013087|Ga0163212_1197687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 629 | Open in IMG/M |
| 3300013372|Ga0177922_11104618 | Not Available | 552 | Open in IMG/M |
| 3300017707|Ga0181363_1013494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1656 | Open in IMG/M |
| 3300017707|Ga0181363_1039219 | Not Available | 873 | Open in IMG/M |
| 3300017716|Ga0181350_1001769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6324 | Open in IMG/M |
| 3300017716|Ga0181350_1057031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter wuianus | 1024 | Open in IMG/M |
| 3300017716|Ga0181350_1058270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter wuianus | 1011 | Open in IMG/M |
| 3300017723|Ga0181362_1103463 | Not Available | 564 | Open in IMG/M |
| 3300017736|Ga0181365_1041010 | Not Available | 1163 | Open in IMG/M |
| 3300017747|Ga0181352_1037532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 1443 | Open in IMG/M |
| 3300017747|Ga0181352_1042449 | Not Available | 1342 | Open in IMG/M |
| 3300017747|Ga0181352_1153477 | Not Available | 608 | Open in IMG/M |
| 3300017754|Ga0181344_1089486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter wuianus | 899 | Open in IMG/M |
| 3300017754|Ga0181344_1191813 | Not Available | 575 | Open in IMG/M |
| 3300017777|Ga0181357_1136118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter wuianus | 913 | Open in IMG/M |
| 3300017778|Ga0181349_1129508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter wuianus | 923 | Open in IMG/M |
| 3300017778|Ga0181349_1314791 | Not Available | 504 | Open in IMG/M |
| 3300017780|Ga0181346_1162940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter wuianus | 827 | Open in IMG/M |
| 3300017785|Ga0181355_1073982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
| 3300017785|Ga0181355_1101358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → unclassified Sphingopyxis → Sphingopyxis sp. MG | 1190 | Open in IMG/M |
| 3300017785|Ga0181355_1281856 | Not Available | 629 | Open in IMG/M |
| 3300017785|Ga0181355_1344273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 549 | Open in IMG/M |
| 3300020160|Ga0211733_11096792 | Not Available | 814 | Open in IMG/M |
| 3300020172|Ga0211729_10143835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2413 | Open in IMG/M |
| 3300020555|Ga0208358_1060668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 542 | Open in IMG/M |
| 3300021961|Ga0222714_10503450 | Not Available | 621 | Open in IMG/M |
| 3300022179|Ga0181353_1029915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 1443 | Open in IMG/M |
| 3300022179|Ga0181353_1088464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
| 3300022179|Ga0181353_1092167 | Not Available | 753 | Open in IMG/M |
| 3300022190|Ga0181354_1101833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 935 | Open in IMG/M |
| 3300022190|Ga0181354_1165022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 684 | Open in IMG/M |
| 3300022190|Ga0181354_1165458 | Not Available | 682 | Open in IMG/M |
| 3300025283|Ga0208048_1056724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300025889|Ga0208644_1107917 | Not Available | 1354 | Open in IMG/M |
| 3300025889|Ga0208644_1142715 | Not Available | 1110 | Open in IMG/M |
| 3300025889|Ga0208644_1297327 | Not Available | 643 | Open in IMG/M |
| 3300025896|Ga0208916_10285923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 717 | Open in IMG/M |
| 3300027146|Ga0255104_1032130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter asymbioticus | 927 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1087239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1438 | Open in IMG/M |
| 3300027764|Ga0209134_10166135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 760 | Open in IMG/M |
| 3300027782|Ga0209500_10276548 | Not Available | 721 | Open in IMG/M |
| 3300027785|Ga0209246_10092169 | Not Available | 1184 | Open in IMG/M |
| 3300027804|Ga0209358_10203791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 1022 | Open in IMG/M |
| 3300027805|Ga0209229_10304720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 702 | Open in IMG/M |
| 3300027899|Ga0209668_10519965 | Not Available | 791 | Open in IMG/M |
| 3300027963|Ga0209400_1295564 | Not Available | 622 | Open in IMG/M |
| 3300031758|Ga0315907_11064934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 578 | Open in IMG/M |
| 3300031758|Ga0315907_11072528 | Not Available | 575 | Open in IMG/M |
| 3300031787|Ga0315900_10739011 | Not Available | 689 | Open in IMG/M |
| 3300031857|Ga0315909_10411159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300031857|Ga0315909_10837014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300031951|Ga0315904_10528740 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300031951|Ga0315904_10901039 | Not Available | 714 | Open in IMG/M |
| 3300031963|Ga0315901_10977816 | Not Available | 594 | Open in IMG/M |
| 3300031963|Ga0315901_11103586 | Not Available | 545 | Open in IMG/M |
| 3300032050|Ga0315906_10345339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1319 | Open in IMG/M |
| 3300032116|Ga0315903_10539777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300033418|Ga0316625_100486666 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 968 | Open in IMG/M |
| 3300033557|Ga0316617_102218789 | Not Available | 567 | Open in IMG/M |
| 3300033978|Ga0334977_0504925 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 550 | Open in IMG/M |
| 3300034019|Ga0334998_0291321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 973 | Open in IMG/M |
| 3300034020|Ga0335002_0202753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1232 | Open in IMG/M |
| 3300034020|Ga0335002_0280600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
| 3300034020|Ga0335002_0460884 | Not Available | 689 | Open in IMG/M |
| 3300034064|Ga0335001_0360831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 785 | Open in IMG/M |
| 3300034104|Ga0335031_0031446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3868 | Open in IMG/M |
| 3300034106|Ga0335036_0006538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9812 | Open in IMG/M |
| 3300034106|Ga0335036_0822699 | Not Available | 535 | Open in IMG/M |
| 3300034109|Ga0335051_0247999 | Not Available | 876 | Open in IMG/M |
| 3300034111|Ga0335063_0541122 | Not Available | 559 | Open in IMG/M |
| 3300034112|Ga0335066_0204403 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
| 3300034122|Ga0335060_0333646 | Not Available | 820 | Open in IMG/M |
| 3300034280|Ga0334997_0806915 | Not Available | 564 | Open in IMG/M |
| 3300034355|Ga0335039_0288515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → unclassified Alishewanella → Alishewanella sp. 34-51-39 | 873 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 29.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 18.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.89% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 6.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.98% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.98% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.98% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.99% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.99% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.99% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.99% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.99% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.99% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001837 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020555 | Freshwater microbial communities from Lake Mendota, WI - 10AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM39_10686402 | 3300001837 | Marine Plankton | ITKEGIPTDSPISAEKRAQQREQLMLHIHELQVKVRLLEEREHMKR* |
| RCM31_101442632 | 3300001851 | Marine Plankton | SPISAERRAQQREQLMVHIHELQVKVRLLEEREKIGRK* |
| B570J40625_1014182102 | 3300002835 | Freshwater | LTKIEGQMPALITKEGVPTDSPISAERRAVLKEQLMTHINDLQVKVRLLEERERLGKK* |
| JGI25912J50252_101480721 | 3300003412 | Freshwater Lake | GVPTDSPISAERRAFMKENLMLHINELQVKVRLLEEREKMGVKK* |
| Ga0049082_100516265 | 3300005584 | Freshwater Lentic | MPALITKEGVPTDSPISAERRAMMKENLMLHINELQVKVRLLEEREKMVKK* |
| Ga0070749_100082428 | 3300006802 | Aqueous | DFSTRLTKIEGAMPALITKEGVPTDSPVSAEKRAVQKEQLMQHINELQVKVRLLEEREKLGKK* |
| Ga0070749_103541812 | 3300006802 | Aqueous | MPALITKEGVPTDSPISAEKRAVLKEQLMQHINELQVKVRLLEEREKLGKK* |
| Ga0075464_105224871 | 3300006805 | Aqueous | ITKEGVPTDSPISAERRALQKEQLMQHINELQVKVRLLEEREKMGKK* |
| Ga0070747_12551132 | 3300007276 | Aqueous | SAERRAIMKEGLMTHINDLQVKVRFLEEREKLAVKK* |
| Ga0114337_10020709 | 3300008262 | Freshwater, Plankton | MMAWSTKEGVPTDSPISAEKRAMQKEALMTHINELQVKVRLLEEREKLGKK* |
| Ga0114363_11328383 | 3300008266 | Freshwater, Plankton | ERRAQMKEQIYKDINDLQVKVKLLEEREKFLKGNK* |
| Ga0114880_12029452 | 3300008450 | Freshwater Lake | ITKEGVPTDSPISAEKRALQKEQLMQHINELQVKVRLLEEREKLGKR* |
| Ga0114980_103003161 | 3300009152 | Freshwater Lake | MPALITKEGIPTDSPISAEKRAMMKEHLMNHINELQVKVRLLEEREKMVKK* |
| Ga0114968_105155621 | 3300009155 | Freshwater Lake | TRIEGAMPALITKEGVPTDSPISAERRAVMKEQLMNHINELQVKVRLLEEREKMVKK* |
| Ga0129333_100621001 | 3300010354 | Freshwater To Marine Saline Gradient | SAEKRALQKEQLMQHINELQVKVRLLEEREKLGKR* |
| Ga0129333_104655364 | 3300010354 | Freshwater To Marine Saline Gradient | MPALITKEGVPTDSPISAERRAAMKEQLMQHINELQVKVRLLEERERLVKK* |
| Ga0129333_105506001 | 3300010354 | Freshwater To Marine Saline Gradient | MPALITKEGVPTDSPVSAEKRAIQKEQLMQHINELQVKVRLLEEREKMGKK* |
| Ga0129333_109024943 | 3300010354 | Freshwater To Marine Saline Gradient | PALITKEGTPTDSPISAERRAQMKEQLMTHINDLQVKVRLLEERERIAKGNK* |
| Ga0129333_111175581 | 3300010354 | Freshwater To Marine Saline Gradient | TKEGTPTDSPISAEKRAILKEQLMQHINELQVKVRLLEERERIAKGGK* |
| Ga0129333_113322581 | 3300010354 | Freshwater To Marine Saline Gradient | TDSPISAERRAAMKEQIYKDINDLQVKVKLLEEREKFMKGYK* |
| Ga0129333_116262561 | 3300010354 | Freshwater To Marine Saline Gradient | EGTPTDSPISAEKRAILKEQLMQHINELQVKVRLLEERERLTKGGK* |
| Ga0133913_100460261 | 3300010885 | Freshwater Lake | PTDSPISADRRAIMKEQLMNHINELQVKVRLLEEREKMGRK* |
| Ga0133913_110090681 | 3300010885 | Freshwater Lake | AMPALITKEGIPTDSPISAEKRAIMKEHLMNHINELQVKVRLLEEREKMGVKK* |
| Ga0153805_10133901 | 3300012013 | Surface Ice | AMPALITKEGVPTDSPISAERRAMMKEQLMNHINELQVKVRLLEEREKMVKK* |
| Ga0157203_10511302 | 3300012663 | Freshwater | DSPVSAERRAIQKEALMLHINELQVKVRLLEEREKMVKK* |
| Ga0157498_10742771 | 3300012666 | Freshwater, Surface Ice | PTDSPISAERRAVLKEGLMNHINELQVKVRLLEEREKLGKK* |
| Ga0164294_109584742 | 3300013006 | Freshwater | ALITKEGVPTDSPISAERRAIMKESLMLHINELQVKVRLLEEREKMVKK* |
| Ga0163212_11976871 | 3300013087 | Freshwater | MPALITKEGVPTDSPVSAEKRAVLKEQLMSHINELQVKVRLIEEREKLGKK* |
| Ga0177922_111046181 | 3300013372 | Freshwater | AERRAVLKEGLMNHINELQVKVRLLEEREKLGKK* |
| Ga0181363_10134941 | 3300017707 | Freshwater Lake | VPTDSPISAERRAQQREQLMTHIHDLQVKVRLLEEREKLGKK |
| Ga0181363_10392191 | 3300017707 | Freshwater Lake | DSPISAERRAIMKEQIYKDINDLQVKVKLLEEREKFLKGNK |
| Ga0181350_10017691 | 3300017716 | Freshwater Lake | TRLTRIEGAMPALITKEGVPTDSPISAERRAMMKENLMLHINELQVKVRLLEEREKMVKK |
| Ga0181350_10570311 | 3300017716 | Freshwater Lake | PISAEKRAVMKENLMQHINELQVKVRLLEEREKMVKK |
| Ga0181350_10582701 | 3300017716 | Freshwater Lake | PTDSPISAERRAMMKENLMLHINELQVKVRLLEEREKMVKK |
| Ga0181362_11034632 | 3300017723 | Freshwater Lake | RIEGAMPALITKEGVPTDSPISAERRAMMKENLMLHINELQVKVRLLEEREKMGKK |
| Ga0181365_10410102 | 3300017736 | Freshwater Lake | MPALITKEGVPTDSPISAERRAMMKENLMLHINELQVKVRLLEEREKMVKK |
| Ga0181352_10375321 | 3300017747 | Freshwater Lake | TRLTRIEGHMPALITKEGVPTDSPVSAEKRAVQKEQLMQHINELQVKVRLLEEREKLGKK |
| Ga0181352_10424494 | 3300017747 | Freshwater Lake | ALITKEGTPTDSPISAERRAIQKEQLMTHINELQVKVRLLEERERIAKGGK |
| Ga0181352_11534772 | 3300017747 | Freshwater Lake | GVPTDSPISAERRAFMKENLMLHINELQVKVRLLEEREKIGAKK |
| Ga0181344_10894861 | 3300017754 | Freshwater Lake | ISAERRAVMKENLMQHINELQVKVRLLEEREKMVKK |
| Ga0181344_11918131 | 3300017754 | Freshwater Lake | KIEGAMPALITKEGVPTDSPISAERRAIMKEQLMNHINELQVKVRLLEEREKIGKK |
| Ga0181357_11361181 | 3300017777 | Freshwater Lake | TDSPISAEKRAVMKEGLMLHINELQVKVRLLEEREKMVKK |
| Ga0181349_11295081 | 3300017778 | Freshwater Lake | GVPTDSPISAERRAMMKENLMLHINELQVKVRLLEEREKMVKK |
| Ga0181349_13147912 | 3300017778 | Freshwater Lake | GVPTDSPISAERRAMMKEQLMLHINELQVKVRLLEEREKMVKK |
| Ga0181346_11629403 | 3300017780 | Freshwater Lake | SAERRAAMKEQLMQHINELQVKVRLLEEREKMVKK |
| Ga0181355_10739821 | 3300017785 | Freshwater Lake | SPISAERRAIMKEQIYKDINDLQVKVKLLEEREKFGKK |
| Ga0181355_11013581 | 3300017785 | Freshwater Lake | EGVPTDSPVSAEKRAVQKEQLMQHINELQVKVRLLEEREKMGRR |
| Ga0181355_12818561 | 3300017785 | Freshwater Lake | EGSMPALITKEGVPTDSPISAERRAIQKEQLMQHINELQVKVRLLEERERLTRK |
| Ga0181355_13442731 | 3300017785 | Freshwater Lake | ITKEGVPTDSPVSAEKRAVQKEQLMHHINELQVKVRLLEEREKLGKR |
| Ga0211733_110967924 | 3300020160 | Freshwater | PTDSPVSAERRAMQKEQLMMHINELQVKVRLLEEREKLGKK |
| Ga0211729_101438354 | 3300020172 | Freshwater | MPALITHDGVPTDSPLSAERRHLLKEQIYKDINELQVRVKLLEEREKINKK |
| Ga0208358_10606681 | 3300020555 | Freshwater | MPALITSTGVPTDSPISAEKRAILKEQLMNHINELQVKVRLLEERERIKGAK |
| Ga0222714_105034501 | 3300021961 | Estuarine Water | SAEKRALQKEQLMQHINELQVKVRLLEEREKMGKK |
| Ga0181353_10299151 | 3300022179 | Freshwater Lake | PVSAEKRAVQKEQLMQHINELQVKVRLLEEREKLGKK |
| Ga0181353_10884641 | 3300022179 | Freshwater Lake | RLTKIEGAMPALITKEGVPTDSPISAEKRAMQKEQLMQHINELQVKVRLLEEREKLGKK |
| Ga0181353_10921673 | 3300022179 | Freshwater Lake | DSPISAERRALLKEQLMLHINDLQVKVKLLEEREKFAKGTK |
| Ga0181354_11018334 | 3300022190 | Freshwater Lake | TISAEKRALQKEQLMQHINELQVKVRLLEEREKMGRK |
| Ga0181354_11650221 | 3300022190 | Freshwater Lake | FSTRLTKIEGSMPALITKEGVPTDSPISAEKRALQKEQLMQHINELQVKVRLLEEREKLGKR |
| Ga0181354_11654582 | 3300022190 | Freshwater Lake | ETKEGTPTDSPISAERRAALKEQLMQQINELQVKVKLLEEREKFIKGAK |
| Ga0208048_10567241 | 3300025283 | Freshwater | TKEGVPTDSPISAEKRAMQKEQLMQHINELQVKVRLLEEREKMNKK |
| Ga0208644_11079171 | 3300025889 | Aqueous | MPALITKEGVPTDSPVSAEKRAVQKEQLMQHINELQVKVRLLEEREKLGKK |
| Ga0208644_11427151 | 3300025889 | Aqueous | ALITKEGTPTDSPISAERRAIQKEQLMTHINELQVKVRLLEERERIKGGK |
| Ga0208644_12973271 | 3300025889 | Aqueous | EGVPTDSPISAERRAMQKEQLMTHINDLQVKVRLLEEREKLGKK |
| Ga0208916_102859233 | 3300025896 | Aqueous | GVPTDSPISAERRALQKEQLMQHINELQVKVRLLEEREKMGKK |
| Ga0255104_10321301 | 3300027146 | Freshwater | RLTRIEGAMPALITKEGVPTDSPISAERRAMMKENLMLHINELQVKVRLLEEREKMVKK |
| (restricted) Ga0247833_10872395 | 3300027730 | Freshwater | PALITKEGVPTDSPISAERRAIQKEALMLHINELQVKVRLLEEREKMGKK |
| Ga0209134_101661353 | 3300027764 | Freshwater Lake | DSPISAERRAFMKENLMLHINELQVKVRLLEEREKMGVKK |
| Ga0209500_102765482 | 3300027782 | Freshwater Lake | STRLTRIEGAMPALITKEGIPTDSLISAERRAMMKEHLMNHINELQVKVRLLEEREKLGK |
| Ga0209246_100921691 | 3300027785 | Freshwater Lake | DSPISAERRAMMKENLMLHINELQVKVRLLEEREKMGKK |
| Ga0209358_102037913 | 3300027804 | Freshwater Lake | TRLTKIEGAMPALITKEGVPTDSPISAEKRALQKEQLMQYINELQVKVRLLEEREKMARK |
| Ga0209229_103047202 | 3300027805 | Freshwater And Sediment | PALITKEGVPTDSPISAERRAILKEQLMTHINDLQVKVRLLEERERIAKGSK |
| Ga0209668_105199651 | 3300027899 | Freshwater Lake Sediment | VPTDSPISAERRAIMKEQIYKDINDLQVKVKLLEEREKFLKGNK |
| Ga0209400_12955641 | 3300027963 | Freshwater Lake | MPALITKEGVPTDSPISAERRAVMKEQLMNHINELQVKVRLLEEREKMVKK |
| Ga0315907_110649341 | 3300031758 | Freshwater | QMPALITKEGIPTDSPISAERRQIQKEQLMQHINELQVKVRLLEERERFKGNK |
| Ga0315907_110725282 | 3300031758 | Freshwater | MPALITKEGVPTDSPISAERRAIQKEQLMQHINELQVKVRLLEERERLTKK |
| Ga0315900_107390112 | 3300031787 | Freshwater | EGVPTDSPISAERRAIMKEQIYKDINDLQVKVKLLEEREKFLKGNK |
| Ga0315909_104111594 | 3300031857 | Freshwater | MPALITKEGVPTDSPVSAERRAIQKEQLMMHINELQVKVRLLEEREKLGKK |
| Ga0315909_108370141 | 3300031857 | Freshwater | PLSAERRAILKEQLLVHINELQVKVRLLEEREKMLKK |
| Ga0315904_105287403 | 3300031951 | Freshwater | EGQMPALITKEGTPTDSPVSAQKRAELKEQLMAHINDLQVKVKLLEEREKFLKGAK |
| Ga0315904_109010392 | 3300031951 | Freshwater | LITREGVPTDSPISAERRAAQKEQLMAHINELQVKVRLLEERERIKGAK |
| Ga0315901_109778161 | 3300031963 | Freshwater | RIEGAMPALITKEGVPTDSPISAERRAMMKENLMLHINELQVKVRLLEEREKMVKK |
| Ga0315901_111035862 | 3300031963 | Freshwater | LITKEGVPTDSPISAERRAIMKEQIYKDINDLQVKVKLLEEREKFLKGNK |
| Ga0315906_103453391 | 3300032050 | Freshwater | MPALITKEGVPTDSPISAERRQIQKEQLMAHINELQVKVRLLEERERIARGNK |
| Ga0315903_105397771 | 3300032116 | Freshwater | PISAERRAIMKEQIYKDINDLQVKVKLLEEREKFGKK |
| Ga0316625_1004866663 | 3300033418 | Soil | AMPALITKEGVPTDSPVSAEKRALQKEQLMQHINELQVKVRLLEEREKLGKR |
| Ga0316617_1022187892 | 3300033557 | Soil | DRLTRIEGQMPALITKEGVPTDSPVSAERRAILKEQLMTHINELQVKVRLLEERERLSKGGK |
| Ga0334977_0504925_2_115 | 3300033978 | Freshwater | PISAERRAIQKEQMMQHINELQVKVRLLEEREKLGKK |
| Ga0334998_0291321_5_151 | 3300034019 | Freshwater | LITKEGVPTDSPISAERRAIQKEQLMQHINELQVKVRLLEEREKMGRK |
| Ga0335002_0202753_1040_1231 | 3300034020 | Freshwater | DFSTRLTKIEGHMPALITKEGVPTDSPVSAEKRAMQKEQFMQHINELQVKVRLLEEREKLGKK |
| Ga0335002_0280600_2_145 | 3300034020 | Freshwater | TREGVPTDSPISAERRAAQKEQLMAHINELQVKVRLLEERERIKGAK |
| Ga0335002_0460884_437_592 | 3300034020 | Freshwater | MPALITKEGVPTDSPISAERRATQKEALMLHINELQVKVRLLEEREKMGKK |
| Ga0335001_0360831_609_767 | 3300034064 | Freshwater | MPALITSTGVPTDSPLSAEKRAILKEQLMNHINELQVKVRLLEERERIKGAK |
| Ga0335031_0031446_3706_3867 | 3300034104 | Freshwater | MPALITKEGTPTDSPISAERRQIQKEQLMQHINELQVKVRLLEERERIAKGGK |
| Ga0335036_0006538_9631_9810 | 3300034106 | Freshwater | LTKIEGSMPALITAQGVPTDSPLSAEKRAILKEQLMTHINELQVKVRLLEERERIKGAK |
| Ga0335036_0822699_380_535 | 3300034106 | Freshwater | ALITKEGVPTDSPISAERRAIMKEQIYKDINDLQVKVKLLEEREKFLKGNK |
| Ga0335051_0247999_713_868 | 3300034109 | Freshwater | MPALITKEGVPTDSPISAEKRAMQKEQLMQHINELQVKVRLLEEREKLGKK |
| Ga0335063_0541122_2_145 | 3300034111 | Freshwater | GGRRIIDSPLSAERRAIMKEQLMMHINDLQVKVKLLEEREKFAKGTK |
| Ga0335066_0204403_1_153 | 3300034112 | Freshwater | LITKEGTPTDSPISAERRAQMKEQIYKDINDLQVKVKLLEEREKFLKGGK |
| Ga0335060_0333646_1_156 | 3300034122 | Freshwater | ALITREGVPTDSPISAERRAVLKEQLMQQINELQVKVKLLEEREKFIKGAK |
| Ga0334997_0806915_379_540 | 3300034280 | Freshwater | MPALITKEGVPTDSPISAERRAIMKEQIYKDINDLQVKVKLLEEREKFLKGNK |
| Ga0335039_0288515_1_129 | 3300034355 | Freshwater | VPTDSPISAEKRALQKEQLMQHINELQVKVRLLEEREKMGRK |
| ⦗Top⦘ |