| Basic Information | |
|---|---|
| Family ID | F102859 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 51 residues |
| Representative Sequence | TSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.99 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 84.16 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (99.010 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (27.723 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.287 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.218 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 2.08% β-sheet: 60.42% Coil/Unstructured: 37.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF03354 | TerL_ATPase | 0.99 |
| PF09636 | XkdW | 0.99 |
| PF13539 | Peptidase_M15_4 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109359265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300002835|B570J40625_100080590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4211 | Open in IMG/M |
| 3300003277|JGI25908J49247_10024487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1768 | Open in IMG/M |
| 3300003393|JGI25909J50240_1010361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2260 | Open in IMG/M |
| 3300004096|Ga0066177_10139984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300004763|Ga0007746_1007998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300004767|Ga0007750_1409027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300004769|Ga0007748_11320986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
| 3300004769|Ga0007748_11637759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300004790|Ga0007758_11075798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300004790|Ga0007758_11343652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300004792|Ga0007761_11037055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300004796|Ga0007763_10037147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
| 3300005528|Ga0068872_10568919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300005582|Ga0049080_10176064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
| 3300006802|Ga0070749_10032571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3240 | Open in IMG/M |
| 3300006805|Ga0075464_10249699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
| 3300007363|Ga0075458_10174762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300007708|Ga0102859_1189411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300008110|Ga0114343_1087473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300008450|Ga0114880_1037874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2111 | Open in IMG/M |
| 3300009155|Ga0114968_10710862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300009163|Ga0114970_10224331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300009183|Ga0114974_10004566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10378 | Open in IMG/M |
| 3300010160|Ga0114967_10280049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300010370|Ga0129336_10508182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300010370|Ga0129336_10699322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300010885|Ga0133913_11072105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2077 | Open in IMG/M |
| 3300010885|Ga0133913_12833152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
| 3300011381|Ga0102688_1535005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300012715|Ga0157599_1200428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300012717|Ga0157609_1140445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300012724|Ga0157611_1236762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300012755|Ga0138281_1095152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300012768|Ga0138276_1166681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300012775|Ga0138280_1106983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300013087|Ga0163212_1143071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10702470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10726196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| (restricted) 3300013138|Ga0172371_10385000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
| 3300013295|Ga0170791_14057527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300013295|Ga0170791_15872036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10611467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300016691|Ga0180055_1163514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300017761|Ga0181356_1002444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7819 | Open in IMG/M |
| 3300017777|Ga0181357_1188707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300017778|Ga0181349_1054186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1567 | Open in IMG/M |
| 3300017778|Ga0181349_1075485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
| 3300017780|Ga0181346_1226750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300019784|Ga0181359_1240296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300020221|Ga0194127_10884891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300020549|Ga0207942_1003368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2484 | Open in IMG/M |
| 3300020551|Ga0208360_1027097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300022190|Ga0181354_1040585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1543 | Open in IMG/M |
| 3300022190|Ga0181354_1097577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300022407|Ga0181351_1191574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300023708|Ga0228709_1093206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300024485|Ga0256318_1067822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
| 3300024487|Ga0255222_1028607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300024531|Ga0255228_1036881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
| 3300024560|Ga0256306_1047249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
| 3300024853|Ga0255252_1119202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300024856|Ga0256304_1072844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300024863|Ga0255246_1111519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300025283|Ga0208048_1084741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300025896|Ga0208916_10234742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300026568|Ga0255240_1057430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
| 3300027608|Ga0208974_1121825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
| 3300027688|Ga0209553_1126115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
| 3300027697|Ga0209033_1010482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4128 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1171378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300027736|Ga0209190_1383943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300027760|Ga0209598_10280685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300027772|Ga0209768_10068738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1811 | Open in IMG/M |
| 3300027798|Ga0209353_10007117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5574 | Open in IMG/M |
| 3300027798|Ga0209353_10401560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300027892|Ga0209550_10411259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300027963|Ga0209400_1001675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17475 | Open in IMG/M |
| 3300027963|Ga0209400_1106870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1291 | Open in IMG/M |
| 3300028025|Ga0247723_1052493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
| 3300028113|Ga0255234_1081198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| 3300028113|Ga0255234_1145116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
| 3300028394|Ga0304730_1167800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
| (restricted) 3300028553|Ga0247839_1152304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
| (restricted) 3300028559|Ga0247831_1094320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1325 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1032669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3439 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1035100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3312 | Open in IMG/M |
| 3300031758|Ga0315907_10294266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1335 | Open in IMG/M |
| 3300031787|Ga0315900_10744894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300032397|Ga0315287_11148648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300034012|Ga0334986_0586496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300034018|Ga0334985_0249258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
| 3300034022|Ga0335005_0587042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300034062|Ga0334995_0562128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300034092|Ga0335010_0237851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300034093|Ga0335012_0466708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300034101|Ga0335027_0124985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1924 | Open in IMG/M |
| 3300034106|Ga0335036_0015205 | All Organisms → cellular organisms → Bacteria | 6261 | Open in IMG/M |
| 3300034112|Ga0335066_0077274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2148 | Open in IMG/M |
| 3300034122|Ga0335060_0005301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8594 | Open in IMG/M |
| 3300034200|Ga0335065_0361999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 27.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 25.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.86% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.90% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.97% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.98% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.99% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.99% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.99% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.99% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004767 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012755 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300016691 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES124 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023708 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024485 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024853 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024856 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026568 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1093592653 | 3300002408 | Freshwater | LDGLLASSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| B570J40625_1000805901 | 3300002835 | Freshwater | EADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG* |
| JGI25908J49247_100244871 | 3300003277 | Freshwater Lake | LLSSSGSTSXKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG* |
| JGI25909J50240_10103611 | 3300003393 | Freshwater Lake | SGSTSIKAAIEVDKTLSGAVQTLRVVSASPGTIQSASIDYLSYQYSVELIG* |
| Ga0066177_101399841 | 3300004096 | Freshwater Lake | ASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0007746_10079981 | 3300004763 | Freshwater Lake | LSSSGSTSIKAAIEVDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG* |
| Ga0007750_14090271 | 3300004767 | Freshwater Lake | SIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0007748_113209862 | 3300004769 | Freshwater Lake | SSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0007748_116377591 | 3300004769 | Freshwater Lake | VGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG* |
| Ga0007758_110757983 | 3300004790 | Freshwater Lake | LIASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0007758_113436523 | 3300004790 | Freshwater Lake | LSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG* |
| Ga0007761_110370551 | 3300004792 | Freshwater Lake | STSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0007763_100371473 | 3300004796 | Freshwater Lake | KAAIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG* |
| Ga0068872_105689191 | 3300005528 | Freshwater Lake | IEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0049080_101760641 | 3300005582 | Freshwater Lentic | DKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG* |
| Ga0070749_100325716 | 3300006802 | Aqueous | SGSTSIKSAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0075464_102496991 | 3300006805 | Aqueous | IKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0075458_101747622 | 3300007363 | Aqueous | LSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG* |
| Ga0102859_11894111 | 3300007708 | Estuarine | KTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG* |
| Ga0114343_10874735 | 3300008110 | Freshwater, Plankton | AIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0114880_10378741 | 3300008450 | Freshwater Lake | IIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG* |
| Ga0114968_107108621 | 3300009155 | Freshwater Lake | TSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG* |
| Ga0114970_102243315 | 3300009163 | Freshwater Lake | SGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0114974_100045661 | 3300009183 | Freshwater Lake | LSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0114967_102800492 | 3300010160 | Freshwater Lake | PTLSGACQTLRVTTATSGSIQVGAIDYLAYRFRTELIG* |
| Ga0129336_105081822 | 3300010370 | Freshwater To Marine Saline Gradient | STSVKTAIEGDATLSGAVQTVRVASATAGSVQIAGNDYLAYRYSLDMIG* |
| Ga0129336_106993221 | 3300010370 | Freshwater To Marine Saline Gradient | SGAVQTLRVTQATSGMITVANIDYLSYRYEVTLIG* |
| Ga0133913_110721051 | 3300010885 | Freshwater Lake | KAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG* |
| Ga0133913_128331521 | 3300010885 | Freshwater Lake | DGQSRLDGLLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0102688_15350052 | 3300011381 | Freshwater Lake | GSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0157599_12004282 | 3300012715 | Freshwater | SSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG* |
| Ga0157609_11404451 | 3300012717 | Freshwater | LLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG* |
| Ga0157611_12367623 | 3300012724 | Freshwater | VMVGRMSEKDGQSRLDGLLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG* |
| Ga0138281_10951521 | 3300012755 | Freshwater Lake | SIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG* |
| Ga0138276_11666811 | 3300012768 | Freshwater Lake | SIKTAIEADKTLSGAVQTLRVVSASPGTVTSANIDYLSYQYSVELIG* |
| Ga0138280_11069831 | 3300012775 | Freshwater Lake | LASSGSSSIKTAIEADKTLSGAVQTLRVVSASPGSITSANIDYLSYQYSVELIG* |
| Ga0163212_11430713 | 3300013087 | Freshwater | LSGAIQTLRVVSATPGTLTSANIDYLSYQYSVELIG* |
| (restricted) Ga0172367_107024701 | 3300013126 | Freshwater | LASSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| (restricted) Ga0172367_107261961 | 3300013126 | Freshwater | SGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| (restricted) Ga0172371_103850004 | 3300013138 | Freshwater | ASSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0170791_140575272 | 3300013295 | Freshwater | LLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| Ga0170791_158720362 | 3300013295 | Freshwater | QSSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG* |
| (restricted) Ga0172376_106114671 | 3300014720 | Freshwater | SSVKAAIEGDVTLSGAVQTLRVTAATAGSVTVAGNDYLAYRYTLELMG* |
| Ga0180055_11635142 | 3300016691 | Freshwater | MVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0181356_100244414 | 3300017761 | Freshwater Lake | ASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0181357_11887071 | 3300017777 | Freshwater Lake | RMSEKDGQSRLDGLLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0181349_10541861 | 3300017778 | Freshwater Lake | ADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0181349_10754851 | 3300017778 | Freshwater Lake | MSEKDGQSRLDGLIASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0181346_12267503 | 3300017780 | Freshwater Lake | EADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0181359_12402961 | 3300019784 | Freshwater Lake | DKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0194127_108848911 | 3300020221 | Freshwater Lake | TLSGAVQTLRVIAATAGSVTVAGNDYLAYRYTLELMG |
| Ga0207942_10033686 | 3300020549 | Freshwater | ERNGQERLDGLLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0208360_10270971 | 3300020551 | Freshwater | GSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0181354_10405851 | 3300022190 | Freshwater Lake | NKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0181354_10975771 | 3300022190 | Freshwater Lake | NSATCNIIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0181351_11915742 | 3300022407 | Freshwater Lake | MSEKDGQSRLDGLLQSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0228709_10932062 | 3300023708 | Freshwater | KTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0256318_10678222 | 3300024485 | Freshwater | GQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0255222_10286071 | 3300024487 | Freshwater | ADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG |
| Ga0255228_10368811 | 3300024531 | Freshwater | AIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG |
| Ga0256306_10472491 | 3300024560 | Freshwater | STSVKAAIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG |
| Ga0255252_11192022 | 3300024853 | Freshwater | FDSATCNIIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0256304_10728441 | 3300024856 | Freshwater | DATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG |
| Ga0255246_11115191 | 3300024863 | Freshwater | LSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0208048_10847411 | 3300025283 | Freshwater | SDKTLSGAIQTLRVVSATPGTLTSANIDYLSYQYSVELIG |
| Ga0208916_102347423 | 3300025896 | Aqueous | DAYLASDGSSSVKAAIEADKTLSGAVQTLRVTQATSGMITVANIDYLSYRYEVTLIG |
| Ga0255240_10574301 | 3300026568 | Freshwater | TGSTSVKAAIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG |
| Ga0208974_11218252 | 3300027608 | Freshwater Lentic | DGLLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0209553_11261153 | 3300027688 | Freshwater Lake | STSIKAAIEVDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0209033_10104826 | 3300027697 | Freshwater Lake | KAAIEADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG |
| (restricted) Ga0247833_11713781 | 3300027730 | Freshwater | NRGFDSATCNIIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0209190_13839431 | 3300027736 | Freshwater Lake | NIIVMVGRMSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0209598_102806851 | 3300027760 | Freshwater Lake | LASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0209768_100687381 | 3300027772 | Freshwater Lake | AIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0209353_100071171 | 3300027798 | Freshwater Lake | EVDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0209353_104015601 | 3300027798 | Freshwater Lake | MVGRMSEKDGQSRLDGLLQSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0209550_104112593 | 3300027892 | Freshwater Lake | DKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0209400_10016751 | 3300027963 | Freshwater Lake | TLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0209400_11068701 | 3300027963 | Freshwater Lake | KAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| Ga0247723_10524935 | 3300028025 | Deep Subsurface Sediment | ERLDGLLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0255234_10811983 | 3300028113 | Freshwater | EADATLSGAVQTLRVTSATAGSVQVASIDYLAYRYNVELIG |
| Ga0255234_11451162 | 3300028113 | Freshwater | EGDVTLGGAVQTLRVTNATAGSVQVASTDYLAYRYNVELIG |
| Ga0304730_11678003 | 3300028394 | Freshwater Lake | QSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELI |
| (restricted) Ga0247839_11523041 | 3300028553 | Freshwater | SRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| (restricted) Ga0247831_10943204 | 3300028559 | Freshwater | MSEKDGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| (restricted) Ga0247843_10326691 | 3300028569 | Freshwater | RLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| (restricted) Ga0247844_10351001 | 3300028571 | Freshwater | IEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0315907_102942661 | 3300031758 | Freshwater | VEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0315900_107448942 | 3300031787 | Freshwater | RNGQERLDGLLASSGSTSIKTAIEADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0315287_111486483 | 3300032397 | Sediment | EKDGQSRLDGLLSSSGSTSIKAAVEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0334986_0586496_267_407 | 3300034012 | Freshwater | VKAAIEGDQTLSGAVQTLRVTQASAGSVQVANIDYLAYRYVVELIG |
| Ga0334985_0249258_1011_1139 | 3300034018 | Freshwater | IEADKTLSGAVLTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0335005_0587042_2_175 | 3300034022 | Freshwater | DGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0334995_0562128_544_669 | 3300034062 | Freshwater | EADKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0335010_0237851_2_124 | 3300034092 | Freshwater | VDKTLGGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0335012_0466708_436_603 | 3300034093 | Freshwater | LLSSSGSTSIKAAIEVDKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0335027_0124985_3_158 | 3300034101 | Freshwater | SGSTSIKAAVEADKTLGGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0335036_0015205_6068_6259 | 3300034106 | Freshwater | DGQSRLDGLLSSSGSTSIKAAIEADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYAVELIG |
| Ga0335066_0077274_1_138 | 3300034112 | Freshwater | KAAVEVDKTLGGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0335060_0005301_8362_8565 | 3300034122 | Freshwater | MSERSGQERLDGLLASSGSTSIKAAVEVDKTLSGAVQTLRVVSASPGTITSANIDYLSYQYSVELIG |
| Ga0335065_0361999_3_125 | 3300034200 | Freshwater | ADKTLSGAVQTLRVVSASPGTITSASIDYLSYQYSVELIG |
| ⦗Top⦘ |