| Basic Information | |
|---|---|
| Family ID | F102794 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 40 residues |
| Representative Sequence | NRSDVMTVAVVARTDPQEQESVVTLSLPPHLAELDDFPVASP |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.05 % |
| % of genes from short scaffolds (< 2000 bps) | 90.10 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.406 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.693 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.723 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.535 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.43% β-sheet: 0.00% Coil/Unstructured: 88.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF02347 | GDC-P | 7.92 |
| PF02659 | Mntp | 1.98 |
| PF08811 | DUF1800 | 0.99 |
| PF07883 | Cupin_2 | 0.99 |
| PF13191 | AAA_16 | 0.99 |
| PF00478 | IMPDH | 0.99 |
| PF07690 | MFS_1 | 0.99 |
| PF13305 | TetR_C_33 | 0.99 |
| PF12681 | Glyoxalase_2 | 0.99 |
| PF10282 | Lactonase | 0.99 |
| PF02738 | MoCoBD_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 7.92 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 7.92 |
| COG1971 | Putative Mn2+ efflux pump MntP | Inorganic ion transport and metabolism [P] | 1.98 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.41 % |
| All Organisms | root | All Organisms | 40.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10283000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 674 | Open in IMG/M |
| 3300005337|Ga0070682_101991770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300005439|Ga0070711_101403572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 608 | Open in IMG/M |
| 3300005542|Ga0070732_10015849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4205 | Open in IMG/M |
| 3300005558|Ga0066698_10741032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300005561|Ga0066699_10569925 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300005615|Ga0070702_100194079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1339 | Open in IMG/M |
| 3300005921|Ga0070766_10033395 | All Organisms → cellular organisms → Bacteria | 2816 | Open in IMG/M |
| 3300006058|Ga0075432_10601228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300006806|Ga0079220_10800448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300007076|Ga0075435_100721692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 866 | Open in IMG/M |
| 3300009521|Ga0116222_1519702 | Not Available | 522 | Open in IMG/M |
| 3300009522|Ga0116218_1547983 | Not Available | 515 | Open in IMG/M |
| 3300009523|Ga0116221_1529332 | Not Available | 517 | Open in IMG/M |
| 3300010047|Ga0126382_12037679 | Not Available | 547 | Open in IMG/M |
| 3300010048|Ga0126373_12249703 | Not Available | 606 | Open in IMG/M |
| 3300010154|Ga0127503_10246999 | Not Available | 846 | Open in IMG/M |
| 3300010341|Ga0074045_10272704 | Not Available | 1114 | Open in IMG/M |
| 3300010379|Ga0136449_101864946 | Not Available | 896 | Open in IMG/M |
| 3300010876|Ga0126361_10182704 | Not Available | 552 | Open in IMG/M |
| 3300012208|Ga0137376_11177518 | Not Available | 655 | Open in IMG/M |
| 3300013307|Ga0157372_11717660 | Not Available | 722 | Open in IMG/M |
| 3300014501|Ga0182024_12858031 | Not Available | 512 | Open in IMG/M |
| 3300015245|Ga0137409_10869535 | Not Available | 737 | Open in IMG/M |
| 3300015374|Ga0132255_106000752 | Not Available | 514 | Open in IMG/M |
| 3300016294|Ga0182041_11938372 | Not Available | 548 | Open in IMG/M |
| 3300017821|Ga0187812_1237238 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300017926|Ga0187807_1113125 | Not Available | 857 | Open in IMG/M |
| 3300017926|Ga0187807_1308748 | Not Available | 526 | Open in IMG/M |
| 3300017932|Ga0187814_10153463 | Not Available | 859 | Open in IMG/M |
| 3300017937|Ga0187809_10053117 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300017943|Ga0187819_10521581 | Not Available | 677 | Open in IMG/M |
| 3300017948|Ga0187847_10358283 | Not Available | 799 | Open in IMG/M |
| 3300018060|Ga0187765_11039847 | Not Available | 564 | Open in IMG/M |
| 3300018062|Ga0187784_10404029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1104 | Open in IMG/M |
| 3300018062|Ga0187784_11133386 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300018090|Ga0187770_11266990 | Not Available | 597 | Open in IMG/M |
| 3300020581|Ga0210399_10338340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1256 | Open in IMG/M |
| 3300020582|Ga0210395_10147202 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300021171|Ga0210405_10073749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2688 | Open in IMG/M |
| 3300021178|Ga0210408_11039069 | Not Available | 632 | Open in IMG/M |
| 3300021180|Ga0210396_11527437 | Not Available | 548 | Open in IMG/M |
| 3300021377|Ga0213874_10229096 | Not Available | 678 | Open in IMG/M |
| 3300021404|Ga0210389_10034166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3907 | Open in IMG/M |
| 3300021405|Ga0210387_10073495 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
| 3300021407|Ga0210383_11786864 | Not Available | 501 | Open in IMG/M |
| 3300021433|Ga0210391_11441039 | Not Available | 529 | Open in IMG/M |
| 3300021444|Ga0213878_10322900 | Not Available | 665 | Open in IMG/M |
| 3300021478|Ga0210402_11726925 | Not Available | 552 | Open in IMG/M |
| 3300022713|Ga0242677_1010070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. YIM 121038 | 1018 | Open in IMG/M |
| 3300025509|Ga0208848_1047930 | Not Available | 913 | Open in IMG/M |
| 3300025907|Ga0207645_10235504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
| 3300025916|Ga0207663_11085909 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 643 | Open in IMG/M |
| 3300025929|Ga0207664_11010407 | Not Available | 745 | Open in IMG/M |
| 3300026078|Ga0207702_11958522 | Not Available | 577 | Open in IMG/M |
| 3300027641|Ga0208827_1017465 | All Organisms → cellular organisms → Bacteria | 2677 | Open in IMG/M |
| 3300027662|Ga0208565_1198267 | Not Available | 572 | Open in IMG/M |
| 3300027765|Ga0209073_10246306 | Not Available | 693 | Open in IMG/M |
| 3300027767|Ga0209655_10054766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1329 | Open in IMG/M |
| 3300027889|Ga0209380_10047521 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300030013|Ga0302178_10476358 | Not Available | 547 | Open in IMG/M |
| 3300030057|Ga0302176_10466808 | Not Available | 510 | Open in IMG/M |
| 3300030509|Ga0302183_10254579 | Not Available | 681 | Open in IMG/M |
| 3300030706|Ga0310039_10185765 | Not Available | 825 | Open in IMG/M |
| 3300030739|Ga0302311_10931982 | Not Available | 554 | Open in IMG/M |
| 3300031233|Ga0302307_10174814 | Not Available | 1111 | Open in IMG/M |
| 3300031546|Ga0318538_10686662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300031546|Ga0318538_10834854 | Not Available | 501 | Open in IMG/M |
| 3300031708|Ga0310686_104961563 | Not Available | 649 | Open in IMG/M |
| 3300031713|Ga0318496_10168728 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300031769|Ga0318526_10212387 | Not Available | 791 | Open in IMG/M |
| 3300031769|Ga0318526_10257106 | Not Available | 715 | Open in IMG/M |
| 3300031781|Ga0318547_10826694 | Not Available | 577 | Open in IMG/M |
| 3300031798|Ga0318523_10270480 | Not Available | 849 | Open in IMG/M |
| 3300031799|Ga0318565_10114228 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 1300 | Open in IMG/M |
| 3300031819|Ga0318568_10652189 | Not Available | 655 | Open in IMG/M |
| 3300031832|Ga0318499_10157034 | Not Available | 887 | Open in IMG/M |
| 3300031845|Ga0318511_10398229 | Not Available | 631 | Open in IMG/M |
| 3300031860|Ga0318495_10033300 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300031910|Ga0306923_10003221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15247 | Open in IMG/M |
| 3300031910|Ga0306923_12532145 | Not Available | 505 | Open in IMG/M |
| 3300031912|Ga0306921_11335839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 791 | Open in IMG/M |
| 3300031947|Ga0310909_10126901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2079 | Open in IMG/M |
| 3300031954|Ga0306926_10916651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1048 | Open in IMG/M |
| 3300031954|Ga0306926_11003670 | Not Available | 993 | Open in IMG/M |
| 3300032043|Ga0318556_10180230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1096 | Open in IMG/M |
| 3300032064|Ga0318510_10103953 | Not Available | 1084 | Open in IMG/M |
| 3300032066|Ga0318514_10337408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 798 | Open in IMG/M |
| 3300032068|Ga0318553_10099167 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300032076|Ga0306924_10634970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus | 1205 | Open in IMG/M |
| 3300032076|Ga0306924_11266684 | Not Available | 794 | Open in IMG/M |
| 3300032089|Ga0318525_10489008 | Not Available | 630 | Open in IMG/M |
| 3300032770|Ga0335085_11510575 | Not Available | 699 | Open in IMG/M |
| 3300032770|Ga0335085_12300212 | Not Available | 539 | Open in IMG/M |
| 3300032805|Ga0335078_10915196 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300032893|Ga0335069_10520024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1377 | Open in IMG/M |
| 3300032896|Ga0335075_11615049 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300032954|Ga0335083_11367955 | Not Available | 542 | Open in IMG/M |
| 3300033289|Ga0310914_10750524 | Not Available | 873 | Open in IMG/M |
| 3300033290|Ga0318519_10827011 | Not Available | 570 | Open in IMG/M |
| 3300034124|Ga0370483_0230730 | Not Available | 632 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.95% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.99% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.99% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.99% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.99% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_102830002 | 3300003505 | Forest Soil | PVNRSDVMTVAVVARTDPQEQESVVTMNLPPHLAELDAFPVASQ* |
| Ga0070682_1019917702 | 3300005337 | Corn Rhizosphere | LPVNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELHDFPVATP* |
| Ga0070711_1014035721 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PVNRSDVMTVAVVARTDPQEQESVVPMSLPPHLSDLESFPVAAQ* |
| Ga0070732_100158494 | 3300005542 | Surface Soil | NRSDVMTIAVVARTDPQEQESVVTLSLPPHLAELNAFPIASP* |
| Ga0066698_107410321 | 3300005558 | Soil | PVNRSDVVTVAVVARTDPQEQESVVIMSLPPHLADLDDFPVASP* |
| Ga0066699_105699251 | 3300005561 | Soil | NRSDVMTIAVVARTDPEEQESVITLTLPPHLADLSAFPVAGH* |
| Ga0070702_1001940791 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | NRSDVMTVAVVARTDPQEQESVVTMTLPPHLAELHDFPVATP* |
| Ga0070766_100333951 | 3300005921 | Soil | HLPVNRSDVMTVAVVARTDPQEQESVITLSLPPHLSDLDAFPVASQ* |
| Ga0075432_106012282 | 3300006058 | Populus Rhizosphere | PVNRSNVTTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP* |
| Ga0079220_108004482 | 3300006806 | Agricultural Soil | VNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELDDLPVASP* |
| Ga0075435_1007216921 | 3300007076 | Populus Rhizosphere | NRSDVMTVAVVARTDPQEQESVVTLSLPPHLAELDDFPVAAP* |
| Ga0116222_15197022 | 3300009521 | Peatlands Soil | MTIAVVARTDPQEQESVVTLTLPPHLAGLSAFPVAAG* |
| Ga0116218_15479832 | 3300009522 | Peatlands Soil | TTVAVVARTDPREQESVVTLTLPPHLAGLSAFPVAAG* |
| Ga0116221_15293321 | 3300009523 | Peatlands Soil | MTVAVVARTDPQEQESVVTMSLPPHLAELDAFPVASQ* |
| Ga0126382_120376791 | 3300010047 | Tropical Forest Soil | SYDGKQGTDPQEQESVVTMSLPPHLAELDDLPVATP* |
| Ga0126373_122497032 | 3300010048 | Tropical Forest Soil | LPVNRSEVTTVAVVARTDPREQESVVTLSLPPHLSDLDAFPVASP* |
| Ga0127503_102469992 | 3300010154 | Soil | VNRSEVTTVAVVARTDPREQESVVTLSRPPHLSDLDAFPVAAG* |
| Ga0074045_102727042 | 3300010341 | Bog Forest Soil | AVVARTDPQEQESVVTMNLPPHLAELDAFPVASQ* |
| Ga0136449_1018649463 | 3300010379 | Peatlands Soil | VAVVARTDPAERESVVTLSLPQHLSELDAFPVASPASPA* |
| Ga0126361_101827042 | 3300010876 | Boreal Forest Soil | AVVARTDPQEQESVVTMTLPPHLADLNDFPVASQ* |
| Ga0137376_111775181 | 3300012208 | Vadose Zone Soil | VNRSEVTTVAVVARTDPREQESVVTLSLPPHLADLDAFPVAAG* |
| Ga0157372_117176602 | 3300013307 | Corn Rhizosphere | VNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELHDFPVATP* |
| Ga0182024_128580311 | 3300014501 | Permafrost | LPVNRSDVMTVAVVARTDPQEQESVVAMTLPPHLSDLNAFPVASQ* |
| Ga0137409_108695352 | 3300015245 | Vadose Zone Soil | VAVVARTDPQEQESVVPMSLPPHLAELDDFPVASP* |
| Ga0132255_1060007522 | 3300015374 | Arabidopsis Rhizosphere | TVAVVARTDPQEQESVVTMSLPPHLAELDGFPVATP* |
| Ga0182041_119383721 | 3300016294 | Soil | PVNRSDVMTVAVVARTDPQEQESVVTVSLPPHLYELNDFPIASQ |
| Ga0187812_12372382 | 3300017821 | Freshwater Sediment | VNRSDVMTVAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ |
| Ga0187807_11131252 | 3300017926 | Freshwater Sediment | TVAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ |
| Ga0187807_13087481 | 3300017926 | Freshwater Sediment | NRSDVMTVAVVARTDPQEQESVVTLSLPPHLSDLNAFPIASQ |
| Ga0187814_101534632 | 3300017932 | Freshwater Sediment | DVMTVAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ |
| Ga0187809_100531171 | 3300017937 | Freshwater Sediment | RSDVMTVAVVARTDPQEQESVVTLSLPPHLSELNAFPVASQ |
| Ga0187819_105215811 | 3300017943 | Freshwater Sediment | VNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELDAFPVASQ |
| Ga0187847_103582832 | 3300017948 | Peatland | VMTVAVVARTDPQEQESVVTMNLPAHLAELNAFPVASQ |
| Ga0187765_110398471 | 3300018060 | Tropical Peatland | HLPVNRSNVMTVAVVARTDPEEQESVVTMKMPPHLAELDAFPVASQ |
| Ga0187784_104040292 | 3300018062 | Tropical Peatland | LPVNRSDVMTVAVVARTDPQEQESVVTLSLPPHLSELNAFPVASP |
| Ga0187784_111333862 | 3300018062 | Tropical Peatland | VAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASP |
| Ga0187770_112669902 | 3300018090 | Tropical Peatland | PVNRSDVTTVAVVARTDPREQESVVTLSLPPHLASLEAFPVAAG |
| Ga0210399_103383402 | 3300020581 | Soil | RSDVMTVAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ |
| Ga0210395_101472022 | 3300020582 | Soil | DVMTVAVVARTDPQEQESVVALSLPPHLSDLDAFPVASQ |
| Ga0210405_100737492 | 3300021171 | Soil | VNRSEVTTVAVVARTDPREQESVVTLSLPPHLADLDAFPVAAG |
| Ga0210408_110390692 | 3300021178 | Soil | VAVVARTDPQEQESVVTMSLPPHLAELDDYPVASP |
| Ga0210396_115274371 | 3300021180 | Soil | TIAVVARTDPQEQESVVTLSLPPHLADLSAFPVATE |
| Ga0213874_102290961 | 3300021377 | Plant Roots | HLPVNRSDVMTVAVVARTDPQEQESVVTMNLPPHLAELDAFPVASQ |
| Ga0210389_100341663 | 3300021404 | Soil | VMTVAVVARTDPQEQESVITLSLPPHLSDLDGFPVASQ |
| Ga0210387_100734951 | 3300021405 | Soil | VAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ |
| Ga0210383_117868641 | 3300021407 | Soil | TVAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ |
| Ga0210391_114410392 | 3300021433 | Soil | LPVNRSDVMTVAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ |
| Ga0213878_103229001 | 3300021444 | Bulk Soil | TVAVVARTDPQEQESVVTLSLPPHLSELDAFPVASQ |
| Ga0210402_117269251 | 3300021478 | Soil | NRSDVMTVAVVARTDPQEQESVVTLSLPPHLAELDDFPVASP |
| Ga0242677_10100702 | 3300022713 | Soil | VNRSDVMTVAVVARTDPQEQESVVTMNLPPHLAELAAFPVASR |
| Ga0208848_10479301 | 3300025509 | Arctic Peat Soil | VAVVARTDPQEQESVVTLSLPPHLAELDDYPVASQ |
| Ga0207645_102355041 | 3300025907 | Miscanthus Rhizosphere | TVAVVARTDPQEQESVVTLSLPPHLAELDDFPVASP |
| Ga0207663_110859091 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTVAVVARTDPQEQESVVPVSLPAHLADLDAFPVASQ |
| Ga0207664_110104072 | 3300025929 | Agricultural Soil | PVNRSDVLTVAVVARTDAQEQESVVPLSLPPHLADLDEVPLASQ |
| Ga0207702_119585222 | 3300026078 | Corn Rhizosphere | TVAVVARTDPQEQESVVTMSLPPHLAELHDFPVATP |
| Ga0208827_10174654 | 3300027641 | Peatlands Soil | TIAVVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ |
| Ga0208565_11982672 | 3300027662 | Peatlands Soil | PVNRSDVMTVAVVARTDPQEQESVVTMTLPPHLAELDAFPVASQ |
| Ga0209073_102463061 | 3300027765 | Agricultural Soil | TVAVVARTDPQEQESVVTMSLPPHLAELDDLPVASP |
| Ga0209655_100547661 | 3300027767 | Bog Forest Soil | SDVMTVAVVARTDPQEQESVVTLSLPPHLSDLDAFPVASQ |
| Ga0209380_100475214 | 3300027889 | Soil | LPVNRSDVMTVAVVARTDPQEQESVITLSLPPHLSDLDAFPVASQ |
| Ga0302178_104763582 | 3300030013 | Palsa | MTVAVVARTDPQEQESVVPMSLPPHLSDLDAFPVAAQ |
| Ga0302176_104668081 | 3300030057 | Palsa | RSDVTTVAVVARTDPQEQESVVTISLPPHLSDLDAFPVASQ |
| Ga0302183_102545792 | 3300030509 | Palsa | NRSDVTTVAVVARTDPQEQESVVTMNLPPHLADLNAFPVASR |
| Ga0310039_101857651 | 3300030706 | Peatlands Soil | PVNRSDVMTVAIVARTDPQEQESVVTLSLPPHLSDLNAFPVASQ |
| Ga0302311_109319821 | 3300030739 | Palsa | DVMTVAVVARTDPQEQESVVTMNLPPHLAELNAFPVASQ |
| Ga0302307_101748142 | 3300031233 | Palsa | TTVAVVARTDPQEQESVVTMNLPPHLAELNAFPVASQ |
| Ga0318538_106866622 | 3300031546 | Soil | TTTVAVVARTDPREQESVVTLSLPPHLAGLDAFPVAAG |
| Ga0318538_108348542 | 3300031546 | Soil | VMTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP |
| Ga0310686_1049615631 | 3300031708 | Soil | NRSDVMTVAVVARTDPQEQESVVTMKLPPHLAELDAFPIASG |
| Ga0318496_101687281 | 3300031713 | Soil | AVVARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT |
| Ga0318526_102123871 | 3300031769 | Soil | NRSDVTTVAVVARTDPQEQESVVTLSLPPHLADLDAFPVASQ |
| Ga0318526_102571061 | 3300031769 | Soil | MTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP |
| Ga0318547_108266941 | 3300031781 | Soil | VMAVAVVAGTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT |
| Ga0318523_102704801 | 3300031798 | Soil | TVAVVARTDPQEQESVVTVSLPPHLYELNDFPIASQ |
| Ga0318565_101142281 | 3300031799 | Soil | DVVTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP |
| Ga0318568_106521891 | 3300031819 | Soil | LTAVAVVARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT |
| Ga0318499_101570341 | 3300031832 | Soil | NRSDVMAVAVVAGTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT |
| Ga0318511_103982292 | 3300031845 | Soil | RSDVMTVAVVARTDPQEQESVVTMSLPPHLADLDDFPVASP |
| Ga0318495_100333002 | 3300031860 | Soil | TVAVVARTDPQEQESVVTMSLPPHLADLDDFPVASP |
| Ga0306923_100032211 | 3300031910 | Soil | TTVAVVARTDPREQESVVTLSLPAHLAGLDAFPVAAG |
| Ga0306923_125321451 | 3300031910 | Soil | VAVVARTDPREQESVVTLSLPPHLADLEAFPVAAG |
| Ga0306921_113358393 | 3300031912 | Soil | SDVTTVAVVARTDPREQESVVTLRLPPHLADLDAFPVAAG |
| Ga0310909_101269011 | 3300031947 | Soil | VTTVAVVARTDPREQESVVTLSLPPHLADLDAFPVAAG |
| Ga0306926_109166511 | 3300031954 | Soil | LPVNRSDVTAAAVVDSTDPHEQESVVTLSLPPHLAELNAFPIASPGTPT |
| Ga0306926_110036702 | 3300031954 | Soil | LPVNRSDVMTVAVVARTDPQEQESVVTLSLPPHLADLDAFPVASQ |
| Ga0318556_101802302 | 3300032043 | Soil | SDVMAVAVVARTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT |
| Ga0318510_101039532 | 3300032064 | Soil | RSDVMTVAVVARTDPQEQESVVTVSLPPHLYELNDFPIASQ |
| Ga0318514_103374082 | 3300032066 | Soil | TVAVVARTDPREQESVVTLSLPAHLAGLDAFPVAAG |
| Ga0318553_100991672 | 3300032068 | Soil | ARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT |
| Ga0306924_106349702 | 3300032076 | Soil | VARTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT |
| Ga0306924_112666841 | 3300032076 | Soil | NRGDLTAVAVVARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT |
| Ga0318525_104890082 | 3300032089 | Soil | VNRSDVMAVAVVAGTDPHEQESVVTLSLPPHLAELNAFPVASPGTPT |
| Ga0335085_115105752 | 3300032770 | Soil | HLPVNRSDVMTVAVVARTDPQEQESVVTVSLPPHLAELDDFPVAAQ |
| Ga0335085_123002121 | 3300032770 | Soil | HLPVNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVATP |
| Ga0335078_109151961 | 3300032805 | Soil | PVNRSDVMTVAVVARTDPQEQESVVTMSLPPHLAELDDFPVASP |
| Ga0335069_105200243 | 3300032893 | Soil | GIPHLPVNRSDVLTVAVVARTDAQEQESVVPLSLPPHLADLDEVPLASQ |
| Ga0335075_116150492 | 3300032896 | Soil | LPVNRSDVMTVAVVARTDPQEQESVVTISLPPHLAELNAFPIASPDTPA |
| Ga0335083_113679552 | 3300032954 | Soil | PVNRSDVMTVAVVARTDPQEQESVVTMKLPPHLAELDAFPVASH |
| Ga0310914_107505241 | 3300033289 | Soil | NRSDVMTIAVVARTDPQEQESVVTLSLPPHLADLDAFPVASP |
| Ga0318519_108270111 | 3300033290 | Soil | VARTDPHEQESVATLSLPPHLAELNAFPVASPGTPT |
| Ga0370483_0230730_506_619 | 3300034124 | Untreated Peat Soil | MTVAVVARTDPQEQESVVTMSLPPHLAELNAFPVASQ |
| ⦗Top⦘ |