Basic Information | |
---|---|
Family ID | F102736 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 43 residues |
Representative Sequence | ALGASGTLTQMDESNMPRIIEALKETARRISRQLQRSGAAGAA |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.98 % |
% of genes near scaffold ends (potentially truncated) | 94.06 % |
% of genes from short scaffolds (< 2000 bps) | 91.09 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.703 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.703 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.406 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF04972 | BON | 83.17 |
PF03009 | GDPD | 9.90 |
PF09339 | HTH_IclR | 1.98 |
PF03572 | Peptidase_S41 | 0.99 |
PF00398 | RrnaAD | 0.99 |
PF01614 | IclR | 0.99 |
PF00857 | Isochorismatase | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 9.90 |
COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.99 |
COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.99 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.99 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10573810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300002562|JGI25382J37095_10086022 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300002914|JGI25617J43924_10047578 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300002914|JGI25617J43924_10263099 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300004091|Ga0062387_101126433 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300004092|Ga0062389_103767739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300004635|Ga0062388_100361606 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300005177|Ga0066690_10149886 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300005180|Ga0066685_10782013 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005181|Ga0066678_10131186 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300005332|Ga0066388_101211087 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300005542|Ga0070732_10583907 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300005558|Ga0066698_10665255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300005568|Ga0066703_10881236 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005598|Ga0066706_10619774 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300005602|Ga0070762_10977658 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300006041|Ga0075023_100194394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
3300006059|Ga0075017_101659934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300006854|Ga0075425_100243744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2068 | Open in IMG/M |
3300007265|Ga0099794_10150969 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300009012|Ga0066710_101349161 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300009038|Ga0099829_11173156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300009038|Ga0099829_11182143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
3300009038|Ga0099829_11347169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300009089|Ga0099828_10528797 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300010303|Ga0134082_10531591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300010325|Ga0134064_10441687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
3300010343|Ga0074044_10875579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300010360|Ga0126372_10246756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1529 | Open in IMG/M |
3300010398|Ga0126383_10479585 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300010858|Ga0126345_1135846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
3300011120|Ga0150983_11282742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300011120|Ga0150983_16583996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
3300011270|Ga0137391_11236368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300012198|Ga0137364_10695603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
3300012202|Ga0137363_11055097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300012208|Ga0137376_10262014 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300012211|Ga0137377_11498863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300012351|Ga0137386_10866556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300012361|Ga0137360_10550893 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300012362|Ga0137361_11810937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300012363|Ga0137390_10412145 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300012363|Ga0137390_11467819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300012685|Ga0137397_10168111 | All Organisms → cellular organisms → Bacteria | 1627 | Open in IMG/M |
3300012685|Ga0137397_11084288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300012918|Ga0137396_10324981 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300012918|Ga0137396_10918573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300012922|Ga0137394_11176407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300012925|Ga0137419_11499615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300012929|Ga0137404_11714701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
3300012929|Ga0137404_11757201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300012930|Ga0137407_11909533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300012977|Ga0134087_10002294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5701 | Open in IMG/M |
3300012986|Ga0164304_11378012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300014166|Ga0134079_10159848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
3300015054|Ga0137420_1344458 | All Organisms → cellular organisms → Bacteria | 2658 | Open in IMG/M |
3300017659|Ga0134083_10206031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
3300018012|Ga0187810_10371562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300018060|Ga0187765_10655749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
3300019789|Ga0137408_1124871 | All Organisms → cellular organisms → Bacteria | 2838 | Open in IMG/M |
3300019789|Ga0137408_1401643 | All Organisms → cellular organisms → Bacteria | 3624 | Open in IMG/M |
3300020199|Ga0179592_10262686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300020580|Ga0210403_11251636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300020581|Ga0210399_10030918 | All Organisms → cellular organisms → Bacteria | 4275 | Open in IMG/M |
3300020581|Ga0210399_11450502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300021046|Ga0215015_10571296 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
3300021088|Ga0210404_10070911 | All Organisms → cellular organisms → Bacteria | 1693 | Open in IMG/M |
3300021168|Ga0210406_11040998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300021178|Ga0210408_10593319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300021181|Ga0210388_11415382 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300021420|Ga0210394_10524300 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300021559|Ga0210409_10729299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
3300021560|Ga0126371_10576183 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300021560|Ga0126371_11316248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
3300021560|Ga0126371_13538736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300022721|Ga0242666_1080687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300022726|Ga0242654_10161912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300024178|Ga0247694_1024256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300024287|Ga0247690_1016666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
3300024330|Ga0137417_1209915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
3300026304|Ga0209240_1130110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
3300026313|Ga0209761_1022361 | All Organisms → cellular organisms → Bacteria | 3932 | Open in IMG/M |
3300026314|Ga0209268_1137102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300026335|Ga0209804_1320284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300026361|Ga0257176_1036377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
3300026523|Ga0209808_1264445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
3300026532|Ga0209160_1007574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8294 | Open in IMG/M |
3300026551|Ga0209648_10341604 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300026557|Ga0179587_10708072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300027591|Ga0209733_1076840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300027842|Ga0209580_10497121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
3300027884|Ga0209275_10640445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300027910|Ga0209583_10100167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
3300028138|Ga0247684_1004319 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
3300029636|Ga0222749_10762637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300031231|Ga0170824_103983016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300031231|Ga0170824_117905771 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300031421|Ga0308194_10101508 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
3300031820|Ga0307473_10934204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
3300031962|Ga0307479_11926912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300033547|Ga0316212_1015914 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.95% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.95% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.96% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.97% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.99% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.99% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.99% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.99% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
3300024287 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK31 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_105738102 | 3300001593 | Forest Soil | TQMDEADMPRIVEALKETARRVSRQLLRGGTSGAA* |
JGI25382J37095_100860222 | 3300002562 | Grasslands Soil | MGNVTAALGASGTLTQTDEDSVPRIIEALKETARRISRQMQKSGVTGAA* |
JGI25617J43924_100475783 | 3300002914 | Grasslands Soil | IFDAIGNVAAALGASGTLTQTDQSNTPRIIESLKETARRISRQLQKRRATGAA* |
JGI25617J43924_102630992 | 3300002914 | Grasslands Soil | MGNVTAALGASGTLTQTDEANMPRIIEALKETARRISRQLQKGAATGTA* |
Ga0062387_1011264331 | 3300004091 | Bog Forest Soil | GGNVAAALGVSGTLTQTDENNMPRIVDALKDAARKISRQTIKAGALGA* |
Ga0062389_1037677391 | 3300004092 | Bog Forest Soil | GVSGTLTQTDENNMPRIVDALKDAARKISRQTIKAGALGA* |
Ga0062388_1003616063 | 3300004635 | Bog Forest Soil | GSVTAALGVSGTLTQMDEENMVKIVDALKETARRISRELLRGGATY* |
Ga0066690_101498863 | 3300005177 | Soil | VTGNVVAALGASGTLTQVDQASMPRIAEALKETARRITRQLHRRGAAGAA* |
Ga0066685_107820132 | 3300005180 | Soil | DTEGNVTAALGASGTLTQTDEVNMPRIIEALKETARRISRQLQKSGATGAA* |
Ga0066678_101311863 | 3300005181 | Soil | GNVTAALGASGTLTQMDEDGMPRIIDALKETARRISRQLQRSGSAGAA* |
Ga0066388_1012110871 | 3300005332 | Tropical Forest Soil | VVAALGASGTLTQVEEASMPRLAESVKETARRISRQLHRSGAAGAA* |
Ga0070732_105839072 | 3300005542 | Surface Soil | DVTGNVVAALGASGTLTQVDEASMPRLAEAVKETARRISRQLQRSGAAGAA* |
Ga0066698_106652551 | 3300005558 | Soil | GTLTQMEEAQLVRIVEAVKEATRRISRQLVRTGAAGPA* |
Ga0066703_108812361 | 3300005568 | Soil | TGNAAAALGASGTLTQVDEPSMPRIVEALKDTARRISRQLQRTGAAGVA* |
Ga0066706_106197741 | 3300005598 | Soil | EGNVTAALGASGTLTQTDEVNMPRIIEALKETARRISRQLQKSGATGAA* |
Ga0070762_109776582 | 3300005602 | Soil | LGVSGTLTQVDEENLPKIVEVLKETARRISRQLARSGAAGAA* |
Ga0075023_1001943941 | 3300006041 | Watersheds | TLTQMDEANLPRILEALKETARRVARQLQRSGGAIPA* |
Ga0075017_1016599342 | 3300006059 | Watersheds | ASGTLTQMDEASMPRVIEALKDTARRISRQLQRSGTAGPA* |
Ga0075425_1002437444 | 3300006854 | Populus Rhizosphere | TLTQVDEASVPRLAEAVKETARRITRQLHRTGAAGAA* |
Ga0099794_101509693 | 3300007265 | Vadose Zone Soil | GASGTLTQMDEANMPRIIEALKETARRISRQLQKSGATGTA* |
Ga0066710_1013491611 | 3300009012 | Grasslands Soil | ALGASGTLTQTDEVNMPRIIEALKETARRISRQLQKSGATGAA |
Ga0099829_111731561 | 3300009038 | Vadose Zone Soil | SGTLTQMEEANLPRILEALKETARRVARQMQRSGATAPA* |
Ga0099829_111821431 | 3300009038 | Vadose Zone Soil | AALGVSGTLTQMEEANLPRILEALKETARRVARQMQRSGALAPA* |
Ga0099829_113471692 | 3300009038 | Vadose Zone Soil | SGTLTQMDESNMPRIIEALKETARRISRQLQRSGAAGAA* |
Ga0099828_105287973 | 3300009089 | Vadose Zone Soil | FDTLGNVTAALGASGTLTQTDEASMPRIIEALKETARRISRQIQKSGLTGAA* |
Ga0134082_105315911 | 3300010303 | Grasslands Soil | TLTQMDENGMPRIIDALKETARRISRQLQRSGSAGAA* |
Ga0134064_104416871 | 3300010325 | Grasslands Soil | NVVAALGASGTLTQVDEASVPRLTEAVKETARRISRQLQRSGATGAA* |
Ga0074044_108755791 | 3300010343 | Bog Forest Soil | VSGTLTQTDENNIARIIDALKDAARRISRQTIKSGALGAIWATKS* |
Ga0126372_102467562 | 3300010360 | Tropical Forest Soil | VVAALSASGTLTQVDQASMPRIAEALKETPRRISRQLQRSSGVGAS* |
Ga0126383_104795853 | 3300010398 | Tropical Forest Soil | ASGTLTQVDEASMPRLADAVKETARRISRQFQRSGSAGAT* |
Ga0126345_11358462 | 3300010858 | Boreal Forest Soil | VSGTLTQMEEANLPRILEALKETARRVSRQMQRSGALAPP* |
Ga0150983_112827422 | 3300011120 | Forest Soil | GVSGTLTQVDEENLSRIAEALKENARRISRQLIKSGASGAA* |
Ga0150983_165839962 | 3300011120 | Forest Soil | GTLTQGDEENLPKIVEAWKETALRISRQLTRSGAAGVA* |
Ga0137391_112363681 | 3300011270 | Vadose Zone Soil | ALGASGTLTQMDESNMPRIIEALKETARRISRQLQRSGAAGAA* |
Ga0137364_106956031 | 3300012198 | Vadose Zone Soil | LGASGTLTQMDEDSMPRIIDALKETARRISRQLQRSGSAGAA* |
Ga0137363_110550972 | 3300012202 | Vadose Zone Soil | TAALGASGTLTQMDESNMPRIIEALKETARRISRQLQRSGAAGAA* |
Ga0137376_102620143 | 3300012208 | Vadose Zone Soil | ASGTLTQTDEANMPRIIEALKETARRISRQLQKSGATGAA* |
Ga0137377_114988631 | 3300012211 | Vadose Zone Soil | MGNVTAALGASGTLTQTDEASMPRIIEALKETARRISRQMQKGGGTGAA* |
Ga0137386_108665562 | 3300012351 | Vadose Zone Soil | GASGTLTQMDEDSMPRIIDALKETARRISRQLQRSGSAGAA* |
Ga0137360_105508933 | 3300012361 | Vadose Zone Soil | QMDESSMPKIIEALKETARRVSRQLLRSGAAGAA* |
Ga0137361_118109372 | 3300012362 | Vadose Zone Soil | GTLTQTDEVDMPRIIDALKETARRISRQLQKSGTTGTA* |
Ga0137390_104121451 | 3300012363 | Vadose Zone Soil | TLTQMDESNMPRIIEALKETARRISRQLQRSGAAGAA* |
Ga0137390_114678192 | 3300012363 | Vadose Zone Soil | LGASGTLTQTDEANMPRIIEALKETARRISRQLQKSGATGTA* |
Ga0137397_101681111 | 3300012685 | Vadose Zone Soil | IGASGTLTQMDEPNMPKMIEALKETARRVSRQLLRSGASGAA* |
Ga0137397_110842882 | 3300012685 | Vadose Zone Soil | TQMDEPNMPKMIEALKETARRVSRQLLHSGAAGAA* |
Ga0137396_103249811 | 3300012918 | Vadose Zone Soil | AALGASGTLTQMGEDSMPRIIDALKETARRISRQLQRSGSAGAA* |
Ga0137396_109185731 | 3300012918 | Vadose Zone Soil | MGNVTAALGASGTLTQTDEAEMPRIIDAIKETARRISRQIQKSGVTGAA* |
Ga0137394_111764072 | 3300012922 | Vadose Zone Soil | DAAGNVTAAIGASGTLTQMDEASMPRMIEALKETARRVSRQLLHSGAAGAA* |
Ga0137419_114996151 | 3300012925 | Vadose Zone Soil | TMGNVTAALGASGTLTQTDEANMPRIIEALKETARRISRQLQKSGATGAA* |
Ga0137404_117147011 | 3300012929 | Vadose Zone Soil | TGNVAAALGASGTLTQTDETDTPRIIEALKDTARRISRQLQRSGATGAA* |
Ga0137404_117572011 | 3300012929 | Vadose Zone Soil | ATIGASRTLTQMDESSMPKSIEPLKETARRVSRQLLRSGAAGAA* |
Ga0137407_119095332 | 3300012930 | Vadose Zone Soil | QMDESSMPKIIEALKETARRASRQLLRSGAAGAA* |
Ga0134087_100022947 | 3300012977 | Grasslands Soil | VAALGASGTLTQVDQASMPRIAEALKETARRITRQLHRRGAAGAA* |
Ga0164304_113780122 | 3300012986 | Soil | TAALGVSGTLKQVDEENLPKIADALKEPARRISRQLLRSGAAGAA* |
Ga0134079_101598482 | 3300014166 | Grasslands Soil | ALGASGTLTQVDEASLPRLTEAVKETARRISRQLQRSGATGAA* |
Ga0137420_13444584 | 3300015054 | Vadose Zone Soil | LTQTDEASMPRIIEALKETARRISRQMQKGGVTGAA* |
Ga0134083_102060312 | 3300017659 | Grasslands Soil | TAALGASGTLTQMDEDNMPRIIDALKETARRISRQLQRSGTAGAA |
Ga0187810_103715622 | 3300018012 | Freshwater Sediment | ASGTLTQMDEVNMPRVIEHLKDAARRISRQLQRMGTAGAA |
Ga0187765_106557491 | 3300018060 | Tropical Peatland | GTVVAALGASGTLTQVDEHSMPRLAEALKETARRISRQLQRSNMPAAG |
Ga0137408_11248714 | 3300019789 | Vadose Zone Soil | GTLTQTDEADMPRIIEALKETARRISRQLQRSGETGAA |
Ga0137408_14016436 | 3300019789 | Vadose Zone Soil | TLTQTDEADMPRIIEALKETARRISRQLQRSGETGAA |
Ga0179592_102626861 | 3300020199 | Vadose Zone Soil | TIFDNMGNVAAALGASGTLTQTDESNMPRIIDALKETARRISRQLQKGGAIGAA |
Ga0210403_112516362 | 3300020580 | Soil | LGVSGTLTQVDEENLPKIVEALQETARRISRHLTRSGVAGAA |
Ga0210399_100309186 | 3300020581 | Soil | AAAALGASGTLTQTDEANMPRIIDALKETARRISRQLQKGGAAGAA |
Ga0210399_114505021 | 3300020581 | Soil | FDNLGNVAAALGASGTLTQTDEANMPRIIDALKDAARRMTRQLQRGGATGAA |
Ga0215015_105712961 | 3300021046 | Soil | LTQVDEPSMPRIIEALKDTARRISRQLQRTGAAGVA |
Ga0210404_100709113 | 3300021088 | Soil | FDTMGNVTAALGASGTLTEMDEANMPRIIEALKESSRRISRQLQKSAATGAA |
Ga0210406_110409981 | 3300021168 | Soil | VSGTLTQADEENLPKIVEALKETARRISRQLMRGGAAGAA |
Ga0210408_105933192 | 3300021178 | Soil | SGTLTQTDEANMPRIIDALKETARRISRQLQKGGAAGAA |
Ga0210388_114153821 | 3300021181 | Soil | SGTLTQMDAAKMPRVAEALKETARRVSRQLLKTGAA |
Ga0210394_105243001 | 3300021420 | Soil | ASGTLTQTDEANMPRIIEALKETARRISRQLQKSGATGAA |
Ga0210409_107292991 | 3300021559 | Soil | ASGTLTETDEANMPRIIEALKESARRISRQLQKSGATGAA |
Ga0126371_105761831 | 3300021560 | Tropical Forest Soil | GNVVAALGASGTLTQVDEASMPRIAEAVKEAARRISRQLHRSGATGAA |
Ga0126371_113162482 | 3300021560 | Tropical Forest Soil | LTQVDEASLPRLAESVKETARRISRQLHRSGAAGAA |
Ga0126371_135387362 | 3300021560 | Tropical Forest Soil | VVAALGASGTLTQVDEASMPRLADAVKETARRISRQFQRSGSAGAM |
Ga0242666_10806872 | 3300022721 | Soil | GVSGTLTQVDEENLPKIVEALKETARRISRQLTRSGAAGVA |
Ga0242654_101619121 | 3300022726 | Soil | VTAALGVSGTLTQADEENLPKIVEALKETARRISRQLTRSGAVGAA |
Ga0247694_10242562 | 3300024178 | Soil | GNVTAALGVSGTLTQVDEENLPKIADALKETARRISRQLLRSGAAGAA |
Ga0247690_10166661 | 3300024287 | Soil | GVSGTLTQVDEENLPKIADALKETARRISRQLLRSGAAGAA |
Ga0137417_12099152 | 3300024330 | Vadose Zone Soil | MGNVTAALGASGTLTQTDEANMPRIIEALKESARRISRQLQKSGATGAA |
Ga0209240_11301101 | 3300026304 | Grasslands Soil | GASGTLTQTDEESMPRIIEALKETARRISRQMQKGGLTGAA |
Ga0209761_10223611 | 3300026313 | Grasslands Soil | ALGASGTLTQTDEDSVPRIIEALKETARRISRQMQKSGVTGAV |
Ga0209268_11371022 | 3300026314 | Soil | AALGASGTLTQTDQTNMPRIIEALKETARRISRQLYKGGLPGAA |
Ga0209804_13202842 | 3300026335 | Soil | TQMDENGMPRIIDALKETARRISRQLQRSGSAGAA |
Ga0257176_10363771 | 3300026361 | Soil | TAALGASGTLTQTDEANMPRIIEALKESARRISRQLQKSGATGAA |
Ga0209808_12644451 | 3300026523 | Soil | LGASGTLTQMDEDNMPRIIDALKETARRISRQLQRSGTAGAVRAGRRPG |
Ga0209160_10075745 | 3300026532 | Soil | VTAAIGASGTLTQMDESSMPKIIEALKETARRVSRQLLRSGAAGAA |
Ga0209648_103416043 | 3300026551 | Grasslands Soil | GASGTLTQTDEANMPRIIEALKESARRISRQLQKSGATGAA |
Ga0179587_107080721 | 3300026557 | Vadose Zone Soil | AAIAALGVSGTLTQMDEANLPRILEALKETGRRVARQIQRGGALALG |
Ga0209733_10768401 | 3300027591 | Forest Soil | TLTQTDEANMPRIIEALKETARRISRQLQKSGTTGAA |
Ga0209580_104971212 | 3300027842 | Surface Soil | DVTGNVVAALGASGTLTQVDEASMPRLAEAVKETARRISRQLQRSGAAGAA |
Ga0209275_106404451 | 3300027884 | Soil | LGVSGTLTQVDEENLPKIVEVLKETARRISRQLARSGAAGAA |
Ga0209583_101001673 | 3300027910 | Watersheds | GTLTQMDEANLPRILEALKETARRVARQLQRIGGAIPA |
Ga0247684_10043194 | 3300028138 | Soil | LTQVDEENLPKIVDALKETARRISRQLMRSGAAGAA |
Ga0222749_107626371 | 3300029636 | Soil | NVTAALGASGTLTQTDEANTPRIIEALKETARRISRQLQKSGATGAA |
Ga0170824_1039830161 | 3300031231 | Forest Soil | QGNVTAALGASGTLTQTDEASMPRIIDALKETARRVSRQLQRSGTTGAA |
Ga0170824_1179057713 | 3300031231 | Forest Soil | GNVTAALGASGTLTQTDEASMPRIIEALKETARRISRQMQKGGVTGAA |
Ga0308194_101015083 | 3300031421 | Soil | GNVTAALGASGTLTQTDDANMPRIIEALKETARRISRQLQKSGATGAAQ |
Ga0307473_109342042 | 3300031820 | Hardwood Forest Soil | SMGNVTAALGASGTLTQTEEADMPRISDALKETARRISRQLQRAGVLGAA |
Ga0307479_119269121 | 3300031962 | Hardwood Forest Soil | VSGTLTQMDEESMVKIVDALKETARRISRQLSRAGQT |
Ga0316212_10159141 | 3300033547 | Roots | GVSGTLTQTDENNMARIVEALKDAARKISRQTIKAGALGI |
⦗Top⦘ |