Basic Information | |
---|---|
Family ID | F102733 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 48 residues |
Representative Sequence | MTAASITKYAAFSRIAVAQARRERGELYGRVAFFAVILGVFSSLWRA |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 95.05 % |
% of genes near scaffold ends (potentially truncated) | 98.02 % |
% of genes from short scaffolds (< 2000 bps) | 96.04 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.010 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.901 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.663 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.495 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.33% β-sheet: 0.00% Coil/Unstructured: 42.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 35.64 |
PF13304 | AAA_21 | 14.85 |
PF08241 | Methyltransf_11 | 0.99 |
PF00004 | AAA | 0.99 |
PF07973 | tRNA_SAD | 0.99 |
PF04199 | Cyclase | 0.99 |
PF04075 | F420H2_quin_red | 0.99 |
PF02472 | ExbD | 0.99 |
PF13555 | AAA_29 | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.99 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.01 % |
Unclassified | root | N/A | 0.99 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_105484071 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300000891|JGI10214J12806_10661086 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300000956|JGI10216J12902_107457365 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300002568|C688J35102_119092679 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300003324|soilH2_10134646 | All Organisms → cellular organisms → Bacteria → PVC group → Chlamydiae → Chlamydiia → Parachlamydiales → Parachlamydiaceae → Parachlamydia → Parachlamydia acanthamoebae | 1356 | Open in IMG/M |
3300004479|Ga0062595_102113743 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300004480|Ga0062592_100546634 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300004643|Ga0062591_100154765 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
3300005169|Ga0066810_10193940 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005171|Ga0066677_10063960 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
3300005288|Ga0065714_10315507 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005290|Ga0065712_10700194 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005294|Ga0065705_10463892 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300005332|Ga0066388_107744140 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300005334|Ga0068869_101035643 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300005338|Ga0068868_101163098 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300005439|Ga0070711_100813975 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300005445|Ga0070708_101557436 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005518|Ga0070699_100619680 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300005534|Ga0070735_10077995 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
3300005545|Ga0070695_101015983 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300005547|Ga0070693_100355673 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
3300005549|Ga0070704_100437616 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300005616|Ga0068852_101857944 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300005616|Ga0068852_102347443 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300005617|Ga0068859_102029224 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300005713|Ga0066905_100282226 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300005713|Ga0066905_100821382 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300005713|Ga0066905_102282232 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300005718|Ga0068866_10138735 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
3300005719|Ga0068861_101796279 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300005764|Ga0066903_105492090 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005844|Ga0068862_100757438 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300006046|Ga0066652_101362285 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300006854|Ga0075425_101053417 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300006881|Ga0068865_100807477 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300006881|Ga0068865_101279028 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300006881|Ga0068865_101342183 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300006903|Ga0075426_11044951 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300006918|Ga0079216_11945661 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300009093|Ga0105240_10494241 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
3300009147|Ga0114129_11509793 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300009156|Ga0111538_13443916 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300009162|Ga0075423_10143820 | All Organisms → cellular organisms → Bacteria | 2504 | Open in IMG/M |
3300009177|Ga0105248_10592558 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300009177|Ga0105248_11829476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
3300009553|Ga0105249_11150329 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300009792|Ga0126374_11479741 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300010047|Ga0126382_10281760 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
3300010358|Ga0126370_10326675 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300010362|Ga0126377_11225424 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300010398|Ga0126383_13639612 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300010400|Ga0134122_11197862 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300010401|Ga0134121_10135399 | All Organisms → cellular organisms → Bacteria | 2091 | Open in IMG/M |
3300010403|Ga0134123_12521692 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300010869|Ga0126359_1422961 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
3300012350|Ga0137372_11055024 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012906|Ga0157295_10145690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300012948|Ga0126375_10470893 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300012951|Ga0164300_10984418 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300012958|Ga0164299_11617704 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300012971|Ga0126369_11478043 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300013306|Ga0163162_10562219 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300014969|Ga0157376_10884677 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300014969|Ga0157376_11792328 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300015372|Ga0132256_100638360 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300015373|Ga0132257_103592809 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300015374|Ga0132255_103911489 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300016341|Ga0182035_11080434 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300018081|Ga0184625_10670270 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300018429|Ga0190272_10072471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2096 | Open in IMG/M |
3300018476|Ga0190274_13581583 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300018920|Ga0190273_10651826 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300018920|Ga0190273_11700419 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300019356|Ga0173481_10703236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300019888|Ga0193751_1185093 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300021560|Ga0126371_11511271 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300022756|Ga0222622_10680905 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300025900|Ga0207710_10464001 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300025913|Ga0207695_10285366 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
3300025938|Ga0207704_11102906 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300025941|Ga0207711_11598877 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300025961|Ga0207712_11488440 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300026121|Ga0207683_10532530 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300026315|Ga0209686_1055337 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
3300027444|Ga0207468_1011194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 514 | Open in IMG/M |
3300027717|Ga0209998_10032935 | Not Available | 1154 | Open in IMG/M |
3300028380|Ga0268265_10624295 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300028380|Ga0268265_12463536 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300028381|Ga0268264_11112162 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300028573|Ga0265334_10329636 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300031716|Ga0310813_10723754 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300031719|Ga0306917_10901453 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300031720|Ga0307469_11488051 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300031768|Ga0318509_10485535 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300031942|Ga0310916_10964322 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300031959|Ga0318530_10189842 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300032180|Ga0307471_103565335 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300032180|Ga0307471_104166693 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300032205|Ga0307472_102631104 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300032211|Ga0310896_10190580 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 6.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.94% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.95% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.99% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.99% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.99% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300027444 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1w-11 (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1054840712 | 3300000364 | Soil | MTAAQFAKYAAFSRISASQAQRERNELYGRMLFFAVILGV |
JGI10214J12806_106610862 | 3300000891 | Soil | MSLSKYVAFARISATHGRYDRTELYGRMAFFVVILGVFSSLWR |
JGI10216J12902_1074573652 | 3300000956 | Soil | MKILVKYLAFARIAAVHAASERAELYGRMVFVAVILGVFSTLWRAVGEYGMPVAVDPE |
C688J35102_1190926791 | 3300002568 | Soil | MTASVVRKYAAFARIAIAQERRGGGELLGRVVFFAVVLGVFSSLYRAVAEAGMPLAG |
soilH2_101346462 | 3300003324 | Sugarcane Root And Bulk Soil | VSASTASKYLAFVRIASALAQRDRGELYGRMVFFAVILGVFSSLWRA |
Ga0062595_1021137432 | 3300004479 | Soil | MTTAHFAKYAGFSRISAREARRERNELYGRMVFFAVILGVFSSL |
Ga0062592_1005466342 | 3300004480 | Soil | MTRLVAKYAAFARIAIAGACRERGDVYGRVAFFAVILGVFSSLWRAAA |
Ga0062591_1001547651 | 3300004643 | Soil | MIPSPLEKYAAFFRIAKRQARQMRGELYGRVLFFAVILGVFSSLWRAVAEAGMPLAADPR |
Ga0066810_101939402 | 3300005169 | Soil | MCHMTLTYVVKHAAYARIAIAQGRRERGELYGRMVFFVVILGVFSSLWRAV |
Ga0066677_100639601 | 3300005171 | Soil | MSAGTIAKYAAFSRISATQAGRERNELYGRMAFFAVILGVFSSLWRAVAEA |
Ga0065714_103155072 | 3300005288 | Miscanthus Rhizosphere | MTRAGAKYAAFVKVAAVKALREPGELYGRVVFFAVVLGVFTSLWQAVGEAGM |
Ga0065712_107001942 | 3300005290 | Miscanthus Rhizosphere | MTRAGAKYAAFVKVAAVKALREPGELYGRVVFFAVVLGVFTSLWQ |
Ga0065705_104638922 | 3300005294 | Switchgrass Rhizosphere | MALLKYVAFARISATHGRYDRAELYGRMAFFVVILGVFSSLWRATREAGLAI |
Ga0066388_1077441401 | 3300005332 | Tropical Forest Soil | MTRHTVRKYAAFVRVAAARARRERGELVGRMLFFAVILGVFSSLW |
Ga0068869_1010356432 | 3300005334 | Miscanthus Rhizosphere | MTAVQIAKYAAFSRISAREAGRERSELYGRMVFFAVILGVFSSLWRAVAEAGMLVTAHPKSLV |
Ga0068868_1011630981 | 3300005338 | Miscanthus Rhizosphere | MKTARAASKYIAFSRVATALARRDRGELYGRMLFFAVILGVFSSLWRAVA |
Ga0070711_1008139751 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTASHVGKYAAFSRIAATQARSERHELYGRMAFFAVILGVFSS |
Ga0070708_1015574362 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAATIGKYAAFARISATQAGRERNELYGRMAFFAVILGVFSSLWRAVAEAGMPVAA |
Ga0070699_1006196802 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLSKYVAFARISAAHGRYDRTELFGRMLFFVVILGVFSSLWRA |
Ga0070735_100779951 | 3300005534 | Surface Soil | MIDAVSVKYAAFFRVAAAQGRREHAELYGRAMFFAVILGVFSSLWRAVAEA |
Ga0070695_1010159832 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAVQIAKYAAFSRISAREAGRERSELYGRMVFFAVILGVFSSLWRAVAEAGMPVTAHPKSL |
Ga0070693_1003556732 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTASIAKYAAFSRVAMAQVRHERGDLAGRVAFFAVILGVFSSLWRAAA |
Ga0070704_1004376162 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAASITKYAAFSRIAVAQARRERGELYGRVAFFAVILGVFSSLWRA |
Ga0068852_1018579442 | 3300005616 | Corn Rhizosphere | MTAALAKYAAFSRVAIAQVRHERGDLAGRVAFFAVILGVFSSLWRAAA |
Ga0068852_1023474432 | 3300005616 | Corn Rhizosphere | MRAAAVSKYVAFARVATALARRDRGELYGRMLFFAVILGVFSSLWRVVAEAGMPIAAD |
Ga0068859_1020292242 | 3300005617 | Switchgrass Rhizosphere | MTAAVVLKYAAIVRVSAAHARQARGELYGRVAFFAVILGVFSSLWHAV |
Ga0066905_1002822261 | 3300005713 | Tropical Forest Soil | MSVRAIGKYAAFARIAVAQTRRERGELLGRVVFFAVVLGVFSSLWRAVAEA |
Ga0066905_1008213822 | 3300005713 | Tropical Forest Soil | MTRFTVSKYAAFFRVAMARARQDRGELLGLMLFFAVILGVFSSLWR |
Ga0066905_1022822321 | 3300005713 | Tropical Forest Soil | MTATRLAKYAAFWRISAREARRERNELYGRMVFFAVILGVFSSLWR |
Ga0068866_101387353 | 3300005718 | Miscanthus Rhizosphere | MTAALAKYAAFSRVAIAQVRHERGDLAGRVAFFAVILGVFSSLWRAAAEAGLPMG |
Ga0068861_1017962792 | 3300005719 | Switchgrass Rhizosphere | MTRLLAKYAAFSRVAIARACREPGDLYGRVVFFAVILGVFSSLWTA |
Ga0066903_1054920901 | 3300005764 | Tropical Forest Soil | MFAAAVKYVAFARVAAALARRDRAELYGRMVFFAVILGVFTSLWRAIADAGMPIAADP |
Ga0068862_1007574381 | 3300005844 | Switchgrass Rhizosphere | MTAAVVRKYAAFVRVAANHARRARGELYGRVVFFAVILGVFSSLWR |
Ga0066652_1013622852 | 3300006046 | Soil | MTAAVAKYAAFARVAAAQVRHERGDLAGRVAFFAV |
Ga0075425_1010534172 | 3300006854 | Populus Rhizosphere | MTAAVAKYVAFARVAAAQVRHERSDLAGRVAFFAVILGVFSSLWRAA |
Ga0068865_1008074772 | 3300006881 | Miscanthus Rhizosphere | MTAVQIAKYAAFSRISAREAGRERSELYGRMVFFAVILGVFSSLWRAV |
Ga0068865_1012790282 | 3300006881 | Miscanthus Rhizosphere | MTAALAKYAAFSRVAIAQVRHERGDLAGRVAFFAVILGVFSS |
Ga0068865_1013421832 | 3300006881 | Miscanthus Rhizosphere | MTAAVVRKYAAFVRVAANHARRARGELYGRVVFFAVILGVFSSLWRAVAEAGM |
Ga0075426_110449511 | 3300006903 | Populus Rhizosphere | MRAAAVSKYVAFARVATALARRDRGELYGRMLFFAVILGVFSSLWRVVAE |
Ga0079216_119456612 | 3300006918 | Agricultural Soil | MKSALKYLAFARVAATEALTERSELYGRIAFLGVLLGVFTALWRAVAEAGMP |
Ga0105240_104942413 | 3300009093 | Corn Rhizosphere | MRAAAVSKYVAFARVATALARRDRGELYGRMLFFAVILGVFSSLWRVVAEAGMP |
Ga0114129_115097931 | 3300009147 | Populus Rhizosphere | MTAAFMAKYAAFARIAAAQARRERGEVYGRVVFFAVILGVFSSLW |
Ga0111538_134439161 | 3300009156 | Populus Rhizosphere | MTADVEKYVAFARVAAAQVRHERGDLAGRVAFFAVILG |
Ga0075423_101438204 | 3300009162 | Populus Rhizosphere | MWRSFFGKYAAFVRIAATSARRDRSELFGRVVFFAVILGVFSS |
Ga0105248_105925582 | 3300009177 | Switchgrass Rhizosphere | MTAAVALKYAGFVRIAAAQARRERGELYGRVTFFAVILGVFTSLWHAVAEAGMPVAA |
Ga0105248_118294761 | 3300009177 | Switchgrass Rhizosphere | MSPWAFARISALHGRYDRAELYGRMAFFVVILGVFTSLWRATREAGLGIAADPRSLV |
Ga0105249_111503291 | 3300009553 | Switchgrass Rhizosphere | MTTAHFAKYAGFSRISAREARRERNELYGRMVFFAVILGVFSSLWRA |
Ga0126374_114797412 | 3300009792 | Tropical Forest Soil | MTRNTIAKYVAFFCVAAARARQDRGELVGRMLFFAVILGVFTSLWRAV |
Ga0126382_102817602 | 3300010047 | Tropical Forest Soil | MTAAQCAKYVAFARISATQARRERSELYGRMVFFAVILGVFS |
Ga0126370_103266752 | 3300010358 | Tropical Forest Soil | MIAARLARYSAFSRIAATQARRERNELYGRMAFFVVILGVFSSLWRAVAEAGMPV |
Ga0126377_112254241 | 3300010362 | Tropical Forest Soil | MIATQLAKYAAFSRIAASQARRERNELYGRMAFFAV |
Ga0126383_136396121 | 3300010398 | Tropical Forest Soil | MIAAPLARYWAFSRISATQARRERNELYGRMAFFVVILGVFSSLW |
Ga0134122_111978622 | 3300010400 | Terrestrial Soil | MRAAAVSKYVAFARVATALARRDRGELYGRMLFFAVILGVF |
Ga0134121_101353991 | 3300010401 | Terrestrial Soil | MTWKYLAFARVAATLARRERGELYGRMLFFAVILGVFASLW |
Ga0134123_125216922 | 3300010403 | Terrestrial Soil | MTRLLAKYAAFSRVAVARACRERGDLYGRVVFFAVILGVFSSLWR |
Ga0126359_14229612 | 3300010869 | Boreal Forest Soil | MKPGAWAKYRAFGRIGARTAVAERGELLGRMAFFAAILGVFSALWRAVAEAGMPIV |
Ga0137372_110550241 | 3300012350 | Vadose Zone Soil | MNRKRLMVLWKYVAFARISARHGRYDRTELYGRMAFFVVILGVFSSLWRATREA |
Ga0157295_101456902 | 3300012906 | Soil | MTGRAGKYTAFLRISFAQARRARGELYGRVVFFVVILGVFSSLWTAVA |
Ga0126375_104708932 | 3300012948 | Tropical Forest Soil | MTALARKYAAFARISVAQARRARAEVYGCAAFFVVILGVFSSLWR |
Ga0164300_109844181 | 3300012951 | Soil | MKATCWTYLAFLRIAASRTCRARGELSGRIVFFGVILGVFSSLWKAVSEAGMP |
Ga0164299_116177041 | 3300012958 | Soil | MKATCWKYLAFLRIAASRTCRARGELSGRIVFFGVILGVFSSL |
Ga0126369_114780432 | 3300012971 | Tropical Forest Soil | MIAAPLARYLAFSRIAATQARRERNELYGRMAFFVVI |
Ga0163162_105622192 | 3300013306 | Switchgrass Rhizosphere | MTTAHFAKYAGFSRISAREARRERNELYGRMVFFAVILGVFSSLWRAVREAG |
Ga0157376_108846773 | 3300014969 | Miscanthus Rhizosphere | MRLVAKYAAFSRVAMARACRERRDIYGRVAFFAVILGVFSS |
Ga0157376_117923281 | 3300014969 | Miscanthus Rhizosphere | MTTAHFAKYAGFSRISAREARRERNELYGRMVFFAVILGVFSSLWR |
Ga0132256_1006383601 | 3300015372 | Arabidopsis Rhizosphere | MKITHALKYIAFLRIAAMQASRARAELYGRAVFFAVILGVFSSLWRAVAE |
Ga0132257_1035928091 | 3300015373 | Arabidopsis Rhizosphere | MITMTCSKYLAFARIATARARRDRGELIGRMAFFAVILGVFSSLWRAVGEAG |
Ga0132255_1039114892 | 3300015374 | Arabidopsis Rhizosphere | MMGRATKYVAFVRISFALARRARGEVYGRVIFFVVILGVFSSLWTAVAEA |
Ga0182035_110804341 | 3300016341 | Soil | MIAARLARYSAFARISATQARRERNELYGRMAFFVVILGVFSSLWRAVAEAGMPVTVVAA |
Ga0184625_106702702 | 3300018081 | Groundwater Sediment | MTHLLAKYAAFSRVAIARACRERGDVYGRVAFFAVILGVFSSLWR |
Ga0190272_100724711 | 3300018429 | Soil | MTRWVAKYAAFSRVAMARACRERGDVYGRVVFFAVILGVFSS |
Ga0190274_135815831 | 3300018476 | Soil | VTAARTLAKYTAFARIAASEGRRAPGELYGRVVFFAVVLGVFSSLWRATR |
Ga0190273_106518262 | 3300018920 | Soil | MTRLVAKYAAFSRIAIARACRERADVYGRVVFFAVI |
Ga0190273_117004191 | 3300018920 | Soil | VTGTRTLAKYAAFIRIAAMQARRDRGELYGRVVFFAVLLGVFSSLWQAT |
Ga0173481_107032362 | 3300019356 | Soil | MTGRAGKYTAFLRISFAQARRARGELYGRVVFFVVILGVFSSLWTAVAEAGM |
Ga0193751_11850932 | 3300019888 | Soil | MTTAFIAKYAAFSRVAVTQARRERGEPYARVAFFAVILGVF |
Ga0126371_115112712 | 3300021560 | Tropical Forest Soil | MIATAFARYSAFSRIAATQACRERNELYGRMAFFVVILGVFSSLWRAVAEAG |
Ga0222622_106809051 | 3300022756 | Groundwater Sediment | MTRLVAKYAAFSRVAIARACRERGDVYGRVVFFAVIL |
Ga0207710_104640011 | 3300025900 | Switchgrass Rhizosphere | MTAALAKYAAFSRVAIAQVRHERGDLAGRVAFFAVILGVF |
Ga0207695_102853661 | 3300025913 | Corn Rhizosphere | MRAAAVSKYVAFARVATALARRDRGELYGRMLFFAVILGVFSSLWRVVAEAGMPIAA |
Ga0207704_111029062 | 3300025938 | Miscanthus Rhizosphere | MTAAVVRKYAAFVRVAANHARRARGELYGRVVFFAVILGVFSSLWRA |
Ga0207711_115988771 | 3300025941 | Switchgrass Rhizosphere | MRTWPSAEKYLAFVRISRTHARRDRGELYGRAMFFVVILGVLASLWRAAGESG |
Ga0207712_114884402 | 3300025961 | Switchgrass Rhizosphere | MTAARFATYAAFSRISASQAQRERNELYGRMLFFAVILGVFSSL |
Ga0207683_105325302 | 3300026121 | Miscanthus Rhizosphere | MTAVQIAKYAAFSRISAREAGRERSELYGRMVFFAVILGVFSSLWRAVAE |
Ga0209686_10553373 | 3300026315 | Soil | MSAGTIAKYAAFSRISATQAGRERNELYGRMAFFAVILGVFSSLWRA |
Ga0207468_10111941 | 3300027444 | Soil | MTAAIAKYAAFSRVAIAQVRHERSDLAGRVAFFAVILG |
Ga0209998_100329351 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MTAVIAKYAAFSRVAIAQVRHERGDLAGRVAFFAVILGVFSSLWRA |
Ga0268265_106242952 | 3300028380 | Switchgrass Rhizosphere | MTAAVVRKYAAFVRVAANHARRARGELYGRVVFFAVIL |
Ga0268265_124635362 | 3300028380 | Switchgrass Rhizosphere | MTAALAKYAAFSRVAIAQVRHERGDLAGRVAFFAVILGVFSSLWRAA |
Ga0268264_111121622 | 3300028381 | Switchgrass Rhizosphere | MTAASFAKYAAFSRISASEARRERSELFGRMAFFAVILGVFSSLW |
Ga0265334_103296362 | 3300028573 | Rhizosphere | MNPIAWAKYRAFWRIGVRTAVNERGELLGRMVFFAALLGVFSALWRTIAEAGMPIATNPRQMVWYL |
Ga0310813_107237542 | 3300031716 | Soil | MTAAVAKYAAFSRISASAAGRDRGELFGRMVFFAVILGVFSSLWRAASEAGLSMTGNPK |
Ga0306917_109014531 | 3300031719 | Soil | VIAAHFARYSAFSRISATQARRERNELYGRMAFFVVILGVFSSLWRAVAEAGMPVAVV |
Ga0307469_114880512 | 3300031720 | Hardwood Forest Soil | MTATAIARYFAFARIAAAQARHERGDLLGRVVFFAVILG |
Ga0318509_104855352 | 3300031768 | Soil | MMAFIVKYAAFSRISVAQARRERGELYGRIVFFAVILG |
Ga0310916_109643221 | 3300031942 | Soil | MIAARLARYSAFARISATQARRERNELYGRMAFFVVILGVFSSLWRAVAEAGMPVAV |
Ga0318530_101898422 | 3300031959 | Soil | MMAFIVKYAAFSRISVAQARRERGELYGRIVFFAVILGVFSSLWRAVAEA |
Ga0307471_1035653351 | 3300032180 | Hardwood Forest Soil | MMAARLGKYAAFARISVAQARRERGELYGRVVFFAVILGVFSSLWRAVAE |
Ga0307471_1041666932 | 3300032180 | Hardwood Forest Soil | MTAAVVAKYAAFSRVAVAQARRAPGELYGRVVFFAVIL |
Ga0307472_1026311042 | 3300032205 | Hardwood Forest Soil | MMKRLSKYAAFARIAALQARRERGELYGRMAFLGVILGVFSALWKAVGEAGMP |
Ga0310896_101905801 | 3300032211 | Soil | MKISHALKYIAFLRIAATQASRARAELYGRAVFFAVILGVFSSL |
⦗Top⦘ |