Metagenome / Metatranscriptome Family F102674

Basic Information
Family ID	F102674
Family Type	Metagenome / Metatranscriptome
Number of Sequences	101
Average Sequence Length	41 residues
Representative Sequence	YRTFETEVNLLANQKSEVKTELVKGSIEQAGPEIKQPQ
Number of Associated Samples	85
Number of Associated Scaffolds	101

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.00 %
% of genes near scaffold ends (potentially truncated)	98.02 %
% of genes from short scaffolds (< 2000 bps)	92.08 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Most Common Taxonomy
Group	Bacteria (85.149 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.812 % of family members)
Environment Ontology (ENVO)	Unclassified (42.574 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (60.396 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 101 Family Scaffolds
PF02274	ADI	14.85
PF00005	ABC_tran	10.89
PF00144	Beta-lactamase	5.94
PF08308	PEGA	3.96
PF13561	adh_short_C2	1.98
PF00092	VWA	1.98
PF09900	DUF2127	1.98
PF08240	ADH_N	1.98
PF14031	D-ser_dehydrat	0.99
PF01425	Amidase	0.99
PF00563	EAL	0.99
PF02405	MlaE	0.99
PF00248	Aldo_ket_red	0.99
PF01381	HTH_3	0.99
PF03030	H_PPase	0.99
PF07676	PD40	0.99
PF00082	Peptidase_S8	0.99
PF08530	PepX_C	0.99
PF10518	TAT_signal	0.99
PF06537	DHOR	0.99
PF03544	TonB_C	0.99
PF00486	Trans_reg_C	0.99
PF04024	PspC	0.99
PF05721	PhyH	0.99
PF01546	Peptidase_M20	0.99
PF00107	ADH_zinc_N	0.99
PF08281	Sigma70_r4_2	0.99
PF13857	Ank_5	0.99
PF13519	VWA_2	0.99
PF00072	Response_reg	0.99
PF02391	MoaE	0.99

COG ID	Name	Functional Category	% Frequency in 101 Family Scaffolds
COG1834	N-Dimethylarginine dimethylaminohydrolase	Amino acid transport and metabolism [E]	14.85
COG4874	Uncharacterized conserved protein	Function unknown [S]	14.85
COG2235	Arginine deiminase	Amino acid transport and metabolism [E]	14.85
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	5.94
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	5.94
COG2367	Beta-lactamase class A	Defense mechanisms [V]	5.94
COG5285	Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.99
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.99
COG5001	Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain	Signal transduction mechanisms [T]	0.99
COG4943	Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains	Signal transduction mechanisms [T]	0.99
COG3808	Na+ or H+-translocating membrane pyrophosphatase	Energy production and conversion [C]	0.99
COG3488	Uncharacterized conserved protein with two CxxC motifs, DUF1111 family	General function prediction only [R]	0.99
COG3434	c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains	Signal transduction mechanisms [T]	0.99
COG2936	Predicted acyl esterase	General function prediction only [R]	0.99
COG2200	EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)	Signal transduction mechanisms [T]	0.99
COG0810	Periplasmic protein TonB, links inner and outer membranes	Cell wall/membrane/envelope biogenesis [M]	0.99
COG0767	Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla	Cell wall/membrane/envelope biogenesis [M]	0.99
COG0314	Molybdopterin synthase catalytic subunit MoaE	Coenzyme transport and metabolism [H]	0.99

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	86.14 %
Unclassified	root	N/A	13.86 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	86.14 %
Unclassified	root	N/A	13.86 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	85.15 %
Unclassified	root	N/A	13.86 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.99 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	21.78 %
Unclassified	root	N/A	13.86 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	9.90 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.99 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	8.91 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	5.94 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.97 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.97 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.99 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.99 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	2.97 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	2.97 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	0.99 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.99 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.99 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	2.97 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2.97 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.99 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	0.99 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.99 %
Ascomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
saccharomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta	0.99 %
Dankookia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia	0.99 %
Streptosporangiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Acidobacterium	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
Dankookia rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	0.99 %
Microbispora	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora	0.99 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.99 %
Pezizomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
leotiomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta	0.99 %
unclassified Microbispora	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora	0.99 %
Dankookia rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	0.99 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
dothideomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta	0.99 %
Microbispora sp. GKU 823	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	0.99 %
Dankookia rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	0.99 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
Dothideomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes	0.99 %
Microbispora sp. GKU 823	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	0.99 %
Dankookia rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	0.99 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
Dothideomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae	0.99 %
Microbispora sp. GKU 823	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	0.99 %
Dankookia rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	0.99 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
Myriangiales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Myriangiales	0.99 %
Microbispora sp. GKU 823	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	0.99 %
Dankookia rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	0.99 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
Elsinoaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Myriangiales → Elsinoaceae	0.99 %
Microbispora sp. GKU 823	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	0.99 %
Dankookia rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	0.99 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
Elsinoe	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Myriangiales → Elsinoaceae → Elsinoe	0.99 %
Microbispora sp. GKU 823	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	0.99 %
Dankookia rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	0.99 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	13.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.91 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	2.97 %
Elsinoe australis	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Myriangiales → Elsinoaceae → Elsinoe → Elsinoe australis	0.99 %
Microbispora sp. GKU 823	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	0.99 %
Dankookia rubra	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	0.99 %
Acidobacterium ailaaui	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	0.99 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.99 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.99 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.99 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.99 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459013\|GO6OHWN02GDON6	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	504	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101992882	All Organisms → cellular organisms → Bacteria	691	Open in IMG/M
3300002560\|JGI25383J37093_10180272	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823	556	Open in IMG/M
3300004080\|Ga0062385_10042116	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1917	Open in IMG/M
3300004080\|Ga0062385_10817128	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300004091\|Ga0062387_101652907	All Organisms → cellular organisms → Bacteria → Acidobacteria	519	Open in IMG/M
3300005163\|Ga0066823_10038554	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	822	Open in IMG/M
3300005177\|Ga0066690_10516931	Not Available	802	Open in IMG/M
3300005343\|Ga0070687_100847624	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300005536\|Ga0070697_100002013	All Organisms → cellular organisms → Bacteria	15582	Open in IMG/M
3300005556\|Ga0066707_10786348	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300005557\|Ga0066704_10049036	All Organisms → cellular organisms → Bacteria	2660	Open in IMG/M
3300005560\|Ga0066670_10471822	Not Available	773	Open in IMG/M
3300005591\|Ga0070761_10716536	All Organisms → cellular organisms → Bacteria	627	Open in IMG/M
3300005610\|Ga0070763_10904971	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300006031\|Ga0066651_10441151	All Organisms → cellular organisms → Bacteria → Acidobacteria	691	Open in IMG/M
3300006034\|Ga0066656_10708087	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300006893\|Ga0073928_10065138	All Organisms → cellular organisms → Bacteria	3193	Open in IMG/M
3300006893\|Ga0073928_10210306	All Organisms → cellular organisms → Bacteria	1516	Open in IMG/M
3300009012\|Ga0066710_100520474	All Organisms → cellular organisms → Bacteria → Proteobacteria	1796	Open in IMG/M
3300009038\|Ga0099829_10233867	All Organisms → cellular organisms → Bacteria	1495	Open in IMG/M
3300009089\|Ga0099828_10368715	Not Available	1294	Open in IMG/M
3300009545\|Ga0105237_10143737	All Organisms → cellular organisms → Bacteria	2380	Open in IMG/M
3300010046\|Ga0126384_11857351	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300010048\|Ga0126373_10940485	All Organisms → cellular organisms → Bacteria → Acidobacteria	929	Open in IMG/M
3300010111\|Ga0127491_1064738	All Organisms → cellular organisms → Bacteria → Acidobacteria	642	Open in IMG/M
3300010303\|Ga0134082_10559311	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	504	Open in IMG/M
3300010358\|Ga0126370_10308199	All Organisms → cellular organisms → Bacteria → Acidobacteria	1259	Open in IMG/M
3300010360\|Ga0126372_10950862	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	866	Open in IMG/M
3300010360\|Ga0126372_11959206	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300010360\|Ga0126372_12556469	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	562	Open in IMG/M
3300010362\|Ga0126377_10933749	All Organisms → cellular organisms → Bacteria	931	Open in IMG/M
3300010362\|Ga0126377_11487660	All Organisms → cellular organisms → Bacteria	751	Open in IMG/M
3300010362\|Ga0126377_11900458	All Organisms → cellular organisms → Bacteria	671	Open in IMG/M
3300010362\|Ga0126377_13343115	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	518	Open in IMG/M
3300010366\|Ga0126379_12690851	Not Available	594	Open in IMG/M
3300011120\|Ga0150983_11187732	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300011270\|Ga0137391_10960987	All Organisms → cellular organisms → Bacteria	697	Open in IMG/M
3300012205\|Ga0137362_10176786	All Organisms → cellular organisms → Bacteria → Proteobacteria	1833	Open in IMG/M
3300012206\|Ga0137380_10559512	All Organisms → cellular organisms → Bacteria	1003	Open in IMG/M
3300012209\|Ga0137379_11427817	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300012362\|Ga0137361_11544471	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300012929\|Ga0137404_11004061	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M
3300012929\|Ga0137404_12308819	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	503	Open in IMG/M
3300012971\|Ga0126369_10005000	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	9757	Open in IMG/M
3300012971\|Ga0126369_10339812	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	1519	Open in IMG/M
3300012971\|Ga0126369_11019768	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300015242\|Ga0137412_10342660	All Organisms → cellular organisms → Bacteria	1165	Open in IMG/M
3300015264\|Ga0137403_11614725	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	502	Open in IMG/M
3300016404\|Ga0182037_10888121	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300017995\|Ga0187816_10125698	All Organisms → cellular organisms → Bacteria	1105	Open in IMG/M
3300019882\|Ga0193713_1065578	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	1032	Open in IMG/M
3300019890\|Ga0193728_1208426	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	815	Open in IMG/M
3300020002\|Ga0193730_1157964	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300020034\|Ga0193753_10112386	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300020579\|Ga0210407_10155795	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1762	Open in IMG/M
3300020579\|Ga0210407_11354355	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300020580\|Ga0210403_10195167	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Myriangiales → Elsinoaceae → Elsinoe → Elsinoe australis	1661	Open in IMG/M
3300020581\|Ga0210399_11190595	All Organisms → cellular organisms → Bacteria	605	Open in IMG/M
3300021088\|Ga0210404_10327906	All Organisms → cellular organisms → Bacteria	847	Open in IMG/M
3300021168\|Ga0210406_10448461	All Organisms → cellular organisms → Bacteria	1027	Open in IMG/M
3300021168\|Ga0210406_10802463	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	716	Open in IMG/M
3300021168\|Ga0210406_11194274	All Organisms → cellular organisms → Bacteria	554	Open in IMG/M
3300021406\|Ga0210386_10142652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1998	Open in IMG/M
3300021433\|Ga0210391_10440352	All Organisms → cellular organisms → Bacteria	1023	Open in IMG/M
3300021478\|Ga0210402_10233824	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui	1695	Open in IMG/M
3300021559\|Ga0210409_11453682	All Organisms → cellular organisms → Bacteria	561	Open in IMG/M
3300021560\|Ga0126371_13289474	Not Available	546	Open in IMG/M
3300024178\|Ga0247694_1022106	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300025922\|Ga0207646_10119991	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2362	Open in IMG/M
3300025928\|Ga0207700_12038694	Not Available	501	Open in IMG/M
3300025929\|Ga0207664_10857231	Not Available	816	Open in IMG/M
3300025941\|Ga0207711_10864708	All Organisms → cellular organisms → Bacteria	841	Open in IMG/M
3300026331\|Ga0209267_1120770	All Organisms → cellular organisms → Bacteria	1104	Open in IMG/M
3300026356\|Ga0257150_1047198	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300026551\|Ga0209648_10559396	All Organisms → cellular organisms → Bacteria	637	Open in IMG/M
3300027521\|Ga0209524_1127135	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300027738\|Ga0208989_10160697	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300027745\|Ga0209908_10092717	All Organisms → cellular organisms → Bacteria	736	Open in IMG/M
3300027857\|Ga0209166_10152514	All Organisms → cellular organisms → Bacteria	1260	Open in IMG/M
3300027889\|Ga0209380_10686028	All Organisms → cellular organisms → Bacteria	589	Open in IMG/M
3300028047\|Ga0209526_10143345	Not Available	1675	Open in IMG/M
3300028806\|Ga0302221_10372441	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300029701\|Ga0222748_1059999	Not Available	671	Open in IMG/M
3300030743\|Ga0265461_11904894	All Organisms → cellular organisms → Bacteria	672	Open in IMG/M
3300031716\|Ga0310813_11723155	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300031720\|Ga0307469_11169404	Not Available	726	Open in IMG/M
3300031740\|Ga0307468_102537260	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	503	Open in IMG/M
3300031754\|Ga0307475_10287674	All Organisms → cellular organisms → Bacteria	1319	Open in IMG/M
3300031754\|Ga0307475_11007096	Not Available	655	Open in IMG/M
3300031770\|Ga0318521_10169908	All Organisms → cellular organisms → Bacteria → Acidobacteria	1247	Open in IMG/M
3300031820\|Ga0307473_10071232	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra	1744	Open in IMG/M
3300031890\|Ga0306925_11643928	All Organisms → cellular organisms → Bacteria	622	Open in IMG/M
3300031912\|Ga0306921_12371251	Not Available	554	Open in IMG/M
3300031942\|Ga0310916_10511629	All Organisms → cellular organisms → Bacteria → Acidobacteria	1022	Open in IMG/M
3300032174\|Ga0307470_11600631	Not Available	545	Open in IMG/M
3300032180\|Ga0307471_100057678	All Organisms → cellular organisms → Bacteria	3253	Open in IMG/M
3300032180\|Ga0307471_100316246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1656	Open in IMG/M
3300032180\|Ga0307471_100932715	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1035	Open in IMG/M
3300032205\|Ga0307472_100260345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1367	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.02%
Host-Associated	Host-Associated	1.98%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	92.08%
Aquatic	Environmental → Aquatic	5.94%
Plants	Host-Associated → Plants	1.98%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	91.09%
Freshwater	Environmental → Aquatic → Freshwater	3.96%
Thermal Springs	Environmental → Aquatic → Thermal Springs	1.98%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.98%
Peat	Environmental → Terrestrial → Peat	0.99%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	78.22%
Loam	Environmental → Terrestrial → Soil → Loam	11.88%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.96%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	1.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.98%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.99%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.99%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.65%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	31.68%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	11.88%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.95%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	2.97%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	1.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.98%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.99%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.99%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.99%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	18.81%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	14.85%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.89%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	9.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.95%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	3.96%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	2.97%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.97%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	2.97%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.97%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	1.98%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.98%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.99%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.99%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.99%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.99%
Thawing Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost	0.99%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.99%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.99%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.99%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.99%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.99%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459013	Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm	Environmental	Open in IMG/M
3300004080	Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental	Open in IMG/M
3300004091	Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental	Open in IMG/M
3300005163	Soil and rhizosphere microbial communities from Laval, Canada - mgHMB	Environmental	Open in IMG/M
3300005177	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006893	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010111	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017995	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1	Environmental	Open in IMG/M
3300019882	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2	Environmental	Open in IMG/M
3300019890	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1	Environmental	Open in IMG/M
3300020002	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1	Environmental	Open in IMG/M
3300020034	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021088	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021406	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024178	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026331	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)	Environmental	Open in IMG/M
3300026356	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300027521	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027738	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)	Environmental	Open in IMG/M
3300027745	Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M	Environmental	Open in IMG/M
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027889	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028806	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1	Environmental	Open in IMG/M
3300029701	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030743	Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031947	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F102674

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
N57_00150110	2170459013	Grass Soil	VELPAYRTFETEVNLLANQESEVKTELVKGSIEQNTPLIKKPDEKQQRIP
INPhiseqgaiiFebDRAFT_1019928823	3300000364	Soil	KHRIKVELPGYRTFETEVNLLPRQKSKVETDLVVGSILQAGPLIKEQ*
JGI25383J37093_101802722	3300002560	Grasslands Soil	KVELPGYRTFETEVNLLPTQKSKVETELIPGSILQAGPLIKEQ*
Ga0062385_100421162	3300004080	Bog Forest Soil	LPGYRTFETEVSLLAGQKPEVKTEVARGSIEQASPDIKPAQ*
Ga0062385_108171282	3300004080	Bog Forest Soil	KVELPGYRTFETEVDLLAGQKSEVKTELVKGSIEQASPDIKPPQ*
Ga0062387_1016529071	3300004091	Bog Forest Soil	ELPGYRTFETEVDLLAGQKSEVKTELVKGSIEQASPDIKPPQ*
Ga0066823_100385541	3300005163	Soil	EVNLLADQETEVKTELVKGSIEQNTPLIKKPEANTQPHS*
Ga0066690_105169311	3300005177	Soil	HHVRIALPGYRTFETDVVLLAAQKSEVKTELVKGSIEQATVEIKKPE*
Ga0070687_1008476241	3300005343	Switchgrass Rhizosphere	KVELPGYRSFDTEVNLLPGQKSEVKTELVKGSIEQASPEIKQPQ*
Ga0070697_1000020131	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	ELPGYRTFETDVEIVERQKSEVKTELVKGSIEQAGSEIKQPQ*
Ga0066707_107863482	3300005556	Soil	PGYRTFETEVNLLPRQKSKVETELVAGSILQAGPLIKEQ*
Ga0066704_100490361	3300005557	Soil	PGYRTFEMEVNLAAGQKSEIKTELVKGSVEQASPLIKQVKQP*
Ga0066670_104718222	3300005560	Soil	VRIALPGYRTFETDVALLAGQKSEVKTELVKGSIEQATAEIKKPE*
Ga0070761_107165361	3300005591	Soil	KVELPGYRTFETEVNLLVNQKSEVKTELVKGSIEQAGPEIKQPQ*
Ga0070763_109049711	3300005610	Soil	ELPGYRTFETEVNLLAGQKSEVKTELVKGSIEQAGTEIKPQQ*
Ga0066651_104411511	3300006031	Soil	GYRTFETEVGLLAGQKSEVKTELVKGSIEQASPEIKEVKEIKNQQ*
Ga0066656_107080871	3300006034	Soil	FDTEINLLANQESEVKTELVPGSIEQNSPLIKKPN*
Ga0073928_100651381	3300006893	Iron-Sulfur Acid Spring	TYDTEINLLAGQKTEVKTVLVPGSIEQAGPLIKKPD*
Ga0073928_102103063	3300006893	Iron-Sulfur Acid Spring	PGYRTYDTEIDLLAGQKTEVKTVLVPGSIEQAGPLIKKPD*
Ga0066710_1005204743	3300009012	Grasslands Soil	LPGYRTFDTEINLLANQESEVKTELDPGSIEQNSPLIKKPDTRQ
Ga0099829_102338674	3300009038	Vadose Zone Soil	ETEVNLLAGQKSEVKTELVKGSIKQASPDIKQPR*
Ga0099828_103687151	3300009089	Vadose Zone Soil	KVGLPGYRTFETELNLLAGQKSEVKTELVKGSIKQATPDIKQPR*
Ga0105237_101437373	3300009545	Corn Rhizosphere	YRTFETEVNLLANQKSEVKTELVKGSIEQAGPEIKQPQ*
Ga0126384_118573511	3300010046	Tropical Forest Soil	ELPGYRTFETEVNLLPKQKSKVETDLVVGSILQAGPLIKEQ*
Ga0126373_109404852	3300010048	Tropical Forest Soil	YRTFETEVTLLAGQKSEVKTELVKGSVEQGSSDIRKNP*
Ga0127491_10647381	3300010111	Grasslands Soil	VKVELPGYRTFETEVNLLPTQKSKVETELIPGSILQAGPLIKEQ*
Ga0134082_105593111	3300010303	Grasslands Soil	KVELPGYRTFETEVNLLPNQKSKVETELIPGSILQAGPLIKEQ*
Ga0126370_103081993	3300010358	Tropical Forest Soil	KVGLPGYRTFETEVNLLAGQKTEVKTELVKGSIKQASPDIKRP*
Ga0126372_109508622	3300010360	Tropical Forest Soil	VELPGYRTFVTEVDLLANQETEVKTELQVGSIEQNSPMIKRPD*
Ga0126372_119592062	3300010360	Tropical Forest Soil	FETEVNLLAGQKSEVRTELVKGSIEQAGPEIKEIKQQQKQ*
Ga0126372_125564692	3300010360	Tropical Forest Soil	ELPGYRTFETEVNLLAGQKAEVKTELFKGSIEQASTDIKAPPRQ*
Ga0126377_109337493	3300010362	Tropical Forest Soil	TFETEVNLLPSQKSKVETELVPGSILQAGPLIKEQ*
Ga0126377_114876602	3300010362	Tropical Forest Soil	PGYRSFETEVSLLPGQKSEVKTELVKGSIEQATTDIKKPE*
Ga0126377_119004581	3300010362	Tropical Forest Soil	LPGYRTFVTDVDLLVDQETEIKTELVAGSIQQNSPVIKKPD*
Ga0126377_133431152	3300010362	Tropical Forest Soil	GYRTFDTEVNLLADQTTEVKTELVVGSIQQNTPLIKKPDQKPQ*
Ga0126379_126908511	3300010366	Tropical Forest Soil	YRTFETEVNLLAGQKSEVKTELVKGSIKQASSDIKQPH*
Ga0150983_111877321	3300011120	Forest Soil	YRTFETDVDVLVGQKSEMKTELVKGSIEQADTEIRKPQ*
Ga0137391_109609872	3300011270	Vadose Zone Soil	RIKVTLPGYQTFETEVNLLPRQKSTIKTELVHGSITQADPLIKKQ*
Ga0137362_101767863	3300012205	Vadose Zone Soil	EINLLANQESEVKTELVPGSIEQNSPLIKKPDARR*
Ga0137380_105595123	3300012206	Vadose Zone Soil	PGYRTFETEVNLLPTQKSKVETELIPGSILQAGPLIKEQ*
Ga0137379_114278172	3300012209	Vadose Zone Soil	ELPGYRTFDTEMNLLANQESEVKTELVPGSIEQNSPLIKKPDIRQ*
Ga0137361_115444712	3300012362	Vadose Zone Soil	ELPAYRTFETGVNLVEKQESEIKTELEKGSIEQNTPLIKKPDDKPQQKPEQK*
Ga0137404_110040611	3300012929	Vadose Zone Soil	TFDTEINLLANQESEVKTELVPGSIEQNSPLIKKPDARH*
Ga0137404_123088191	3300012929	Vadose Zone Soil	TFDTEINLLANQESEVKTELVPGSIEQNSPLIKKPDIRQ*
Ga0126369_100050001	3300012971	Tropical Forest Soil	RTFLTEVDLLANQETEVKTELIPGSIQQNTPIIKKPD*
Ga0126369_103398121	3300012971	Tropical Forest Soil	RTFETEVNLVAGQKSEVKTELVKGSIQQASPDIKKPQ*
Ga0126369_110197682	3300012971	Tropical Forest Soil	ETEVNLLPNQKSEVKTELVKGSIEQASPEIKQPQ*
Ga0137412_103426602	3300015242	Vadose Zone Soil	YRTFETEVNLLVNQKSEVKTELVKGSIEQAGPEIKQPQ*
Ga0137403_116147252	3300015264	Vadose Zone Soil	RVELPGYRTFDTEMNLLANQESEVKTELVPGSIEQNSPLIKKPDIRQ*
Ga0182037_108881211	3300016404	Soil	PGYRTFLTEVDLLANQETEVKTELVPGSIEQNTPIIKKPDAQ
Ga0187816_101256981	3300017995	Freshwater Sediment	ELAGYRTFDTDVTLIAGQKSEVKTELVKGSIEDAGSEIKKH
Ga0193713_10655782	3300019882	Soil	LPAYRTFETEVNLLANQESEIKTELVKGSIEQNTPLIKKPDDKPQQKPEQK
Ga0193728_12084263	3300019890	Soil	YRTYETEINLLAGQKTEVKTELVKGSIEQAGPLIKKPN
Ga0193730_11579642	3300020002	Soil	LPGYRTYDTEINLLAGQKTEVKTVLVPGSIEQAGPLIKKPN
Ga0193753_101123861	3300020034	Soil	LPAYRTFETEVNLLANQESEIKTELVKGSIEQNTPLIKKPDDQPQQKPGQEQ
Ga0210407_101557951	3300020579	Soil	PGYRTYETEVDVLAGQKAEVKTELVKGSIEQAGSDIKKPQ
Ga0210407_113543551	3300020579	Soil	LPGYRTFETDVDVLVGQKSEMKTELVKGSIEQADTEIKKPQ
Ga0210403_101951671	3300020580	Soil	YRTFETEVNLLRGQKSEVKTELVKGSIEQGGPDIKPPQ
Ga0210399_111905951	3300020581	Soil	TYETDVNVVVGQKSEMKTELVKGSIEQADTEIKKPQ
Ga0210404_103279062	3300021088	Soil	YRTYDTEINLLAGQKTEVKTVLVPGSIEQAGPLIKKPD
Ga0210406_104484611	3300021168	Soil	GYRTYETEVDVLAGQKAEVKTELVKGSIEQAGSDIKKPQ
Ga0210406_108024631	3300021168	Soil	FDTVVDLLPKQKSEVKTELAKGSIEQASPDIKPPQ
Ga0210406_111942741	3300021168	Soil	FETDVDVLVGQKSEMKTELVKGSIEQADTEIKKPQ
Ga0210386_101426523	3300021406	Soil	RTFETEVNLLQGQKSEVKTELVKGSIEQSGPDVKPPQ
Ga0210391_104403522	3300021433	Soil	LPGYRTFETEVNVLAGQKSEVKTELLKGSIEQAGSDIKQPQ
Ga0210402_102338243	3300021478	Soil	GYRTFETEVNLLAGQKSEVKTELVKGSIEQAGSEIKPQQ
Ga0210409_114536822	3300021559	Soil	TFETEVNLLVGQKSEVKTELVKGSIEQAGPEIKEIKQPN
Ga0126371_132894741	3300021560	Tropical Forest Soil	TFETEVNLLANQKSEVKTELVKGSIEQAGPEIKQP
Ga0247694_10221061	3300024178	Soil	IKVELPGYRTFETDVEIVERQKSEVKTELVKGSIEQAGSEIKQPQ
Ga0207646_101199913	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	DTEINLLANQESEVKTELVPGSIQQNSPLIKKPDARQ
Ga0207700_120386942	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	PGYRTFETEVNLLAGQKSEVKTELVKGSIQQATPEIKHL
Ga0207664_108572312	3300025929	Agricultural Soil	ETEVNLLAGQKSEIKTELVKGSIEQAGPLIKEPQTVSQNPGR
Ga0207711_108647081	3300025941	Switchgrass Rhizosphere	PGYRTFVTEVDLLANQQTEVKTELQVGSIQQNTPIIKKPD
Ga0209267_11207701	3300026331	Soil	FETEVSLLAGQKSEVKTELVKGSIEQASPEIKNQE
Ga0257150_10471982	3300026356	Soil	AYRTFETEVNLLANQESEIKTELVKGSIEQNTPLIKKPDDKPQQQKQ
Ga0209648_105593961	3300026551	Grasslands Soil	PGYRTFETEVDLLQGQKSEVKTELVKGSIEQAGPDMKSPQ
Ga0209524_11271352	3300027521	Forest Soil	KVELPGYRTFETEVNLLAGQKSEVKTELVKGSIVQAGPEIKQPN
Ga0208989_101606971	3300027738	Forest Soil	TYDTEINLLAGQKTEVKTVLVPGSIEQAGPLIKKKD
Ga0209908_100927171	3300027745	Thawing Permafrost	TFETEVNLLVNQKSEVKTELVKGSIEQAGPEIKQPQ
Ga0209166_101525143	3300027857	Surface Soil	TFVTEVDLLPNQETQVKTELVAGSIEQNTPIIKKPDTKP
Ga0209380_106860282	3300027889	Soil	PGYRTFETEVNLLQGQKSEVKTELVKGSIEQAGPDVKPPQ
Ga0209526_101433451	3300028047	Forest Soil	PGYRTFETEVNLLAGQKSEIKTELVKGSIEQAGPLIKEPEKQSENPGR
Ga0302221_103724412	3300028806	Palsa	TFDTTVDLLPNQKSEVKTELVKGSIEQAGPEIKQQP
Ga0222748_10599992	3300029701	Soil	PGYRTFETEVNLLAGQKSEVKTELAKGSIEQASPDIKAPQ
Ga0265461_119048942	3300030743	Soil	LPGYRTFETDVNVLVGQKSEMKTELVKGSIEQAGAEIKKP
Ga0310813_117231551	3300031716	Soil	YRTFETEVNLLPRQKSKVETDLVVGSILQAGSLIKEQ
Ga0307469_111694041	3300031720	Hardwood Forest Soil	GYQTFETEINLLAHQKSEVKTELVRGSIEQAGALVKQP
Ga0307468_1025372601	3300031740	Hardwood Forest Soil	LPGYRTFETEINLLPKQKFTVKTELVKGSITQADPLIKKEEKP
Ga0307475_102876741	3300031754	Hardwood Forest Soil	GYRTFETELNLLANQESEIKTELAKGSIEQNTPLIKKPDDKPEQRP
Ga0307475_110070962	3300031754	Hardwood Forest Soil	FETEVDLLQGQKSEVKTELVKGSIEQAGPDVKPPQ
Ga0318521_101699081	3300031770	Soil	ELPGYRTFETEVTLLAGQKSEVKTELVKGSVEQGSSDIRKNP
Ga0307473_100712324	3300031820	Hardwood Forest Soil	TFETEVNLLAGQKSELKTELVKGSIEQASPAIKPPK
Ga0306925_116439281	3300031890	Soil	FVTEVDLLANQETEVKTELRVGSIEQNSPVIKKPD
Ga0306921_123712511	3300031912	Soil	ELPGYRTFMTEVDLLANQETEVKTELVPGSIEQNTPIIKKPDTK
Ga0310916_105116291	3300031942	Soil	VELPGYRTFETEVTLLAGQKSEVKTELVKGSVEQGSSDIRKNP
Ga0310909_110768732	3300031947	Soil	ELNLLANQESEIKTELIPGSIEQNSPLIKKPDEKQSQKP
Ga0307470_116006312	3300032174	Hardwood Forest Soil	TFDTEVNLLADQETEVKTELKVGSIEQNTPLIKKPDVKQ
Ga0307471_1000576781	3300032180	Hardwood Forest Soil	IELPGYRTFETEVNLLAGQKTEVKTELVKGSIQQAGALIKQSS
Ga0307471_1003162461	3300032180	Hardwood Forest Soil	LPGYRTFVTEVDLLANQETEVKTELQIGSIEQNSPMIKRPDTD
Ga0307471_1009327152	3300032180	Hardwood Forest Soil	PGYRTFETELNLLAGQKSEVKTELVKGSIKQATPDIKQPQ
Ga0307472_1002603451	3300032205	Hardwood Forest Soil	YRTYDTEVNLHANQVSEVKTELPKGSIEQNTPLIKKPDDKPEQRP

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign