| Basic Information | |
|---|---|
| Family ID | F102669 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GDEEVTTGDIVHAIGQTRRTLTPELVAEFEQDIQDYARV |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.07 % |
| % of genes from short scaffolds (< 2000 bps) | 91.09 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.267 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.762 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.792 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.624 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 7.92 |
| PF00501 | AMP-binding | 3.96 |
| PF07311 | Dodecin | 2.97 |
| PF00571 | CBS | 1.98 |
| PF02518 | HATPase_c | 1.98 |
| PF07883 | Cupin_2 | 1.98 |
| PF03435 | Sacchrp_dh_NADP | 0.99 |
| PF13411 | MerR_1 | 0.99 |
| PF00378 | ECH_1 | 0.99 |
| PF00485 | PRK | 0.99 |
| PF01833 | TIG | 0.99 |
| PF01638 | HxlR | 0.99 |
| PF02776 | TPP_enzyme_N | 0.99 |
| PF09995 | MPAB_Lcp_cat | 0.99 |
| PF01058 | Oxidored_q6 | 0.99 |
| PF00082 | Peptidase_S8 | 0.99 |
| PF00753 | Lactamase_B | 0.99 |
| PF00881 | Nitroreductase | 0.99 |
| PF00368 | HMG-CoA_red | 0.99 |
| PF02899 | Phage_int_SAM_1 | 0.99 |
| PF00884 | Sulfatase | 0.99 |
| PF13185 | GAF_2 | 0.99 |
| PF06032 | DUF917 | 0.99 |
| PF06974 | WS_DGAT_C | 0.99 |
| PF14486 | DUF4432 | 0.99 |
| PF02371 | Transposase_20 | 0.99 |
| PF01095 | Pectinesterase | 0.99 |
| PF01243 | Putative_PNPOx | 0.99 |
| PF01641 | SelR | 0.99 |
| PF00107 | ADH_zinc_N | 0.99 |
| PF08281 | Sigma70_r4_2 | 0.99 |
| PF12802 | MarR_2 | 0.99 |
| PF01734 | Patatin | 0.99 |
| PF00581 | Rhodanese | 0.99 |
| PF00196 | GerE | 0.99 |
| PF13561 | adh_short_C2 | 0.99 |
| PF00582 | Usp | 0.99 |
| PF03976 | PPK2 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 2.97 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 0.99 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.99 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.99 |
| COG4677 | Pectin methylesterase and related acyl-CoA thioesterases | Carbohydrate transport and metabolism [G] | 0.99 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.99 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.99 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.99 |
| COG3535 | Uncharacterized conserved protein, DUF917 family | Function unknown [S] | 0.99 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.99 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 0.99 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.99 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 0.99 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.99 |
| COG1257 | Hydroxymethylglutaryl-CoA reductase | Lipid transport and metabolism [I] | 0.99 |
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.27 % |
| Unclassified | root | N/A | 26.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02HPRZV | Not Available | 512 | Open in IMG/M |
| 3300005332|Ga0066388_104702734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300005434|Ga0070709_10505693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 918 | Open in IMG/M |
| 3300005434|Ga0070709_10718573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 778 | Open in IMG/M |
| 3300005435|Ga0070714_100901632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 858 | Open in IMG/M |
| 3300005435|Ga0070714_101382343 | Not Available | 687 | Open in IMG/M |
| 3300005471|Ga0070698_101954965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia vinacea | 540 | Open in IMG/M |
| 3300005542|Ga0070732_10980803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 517 | Open in IMG/M |
| 3300006034|Ga0066656_11027627 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006102|Ga0075015_100284341 | Not Available | 905 | Open in IMG/M |
| 3300006893|Ga0073928_11065787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300006954|Ga0079219_12422119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300009029|Ga0066793_10168261 | Not Available | 1277 | Open in IMG/M |
| 3300009522|Ga0116218_1243812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
| 3300009792|Ga0126374_11379228 | Not Available | 573 | Open in IMG/M |
| 3300010364|Ga0134066_10364021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae | 540 | Open in IMG/M |
| 3300010376|Ga0126381_104368723 | Not Available | 547 | Open in IMG/M |
| 3300010379|Ga0136449_103417658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 607 | Open in IMG/M |
| 3300010398|Ga0126383_12423660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300012201|Ga0137365_11119743 | Not Available | 566 | Open in IMG/M |
| 3300012207|Ga0137381_10841569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 794 | Open in IMG/M |
| 3300012351|Ga0137386_10246946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1283 | Open in IMG/M |
| 3300012363|Ga0137390_10086661 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
| 3300012683|Ga0137398_10718913 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300012927|Ga0137416_10895334 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300013308|Ga0157375_10708517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1160 | Open in IMG/M |
| 3300014150|Ga0134081_10424819 | Not Available | 503 | Open in IMG/M |
| 3300015245|Ga0137409_10319339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1361 | Open in IMG/M |
| 3300015371|Ga0132258_10342445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3694 | Open in IMG/M |
| 3300016270|Ga0182036_10923453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300016270|Ga0182036_11476244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300016341|Ga0182035_11112345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 703 | Open in IMG/M |
| 3300016357|Ga0182032_10936774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300016387|Ga0182040_11416016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
| 3300017924|Ga0187820_1055570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1077 | Open in IMG/M |
| 3300017926|Ga0187807_1298931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300017942|Ga0187808_10218219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300017961|Ga0187778_10224119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1202 | Open in IMG/M |
| 3300017995|Ga0187816_10583174 | Not Available | 503 | Open in IMG/M |
| 3300018001|Ga0187815_10390544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300018012|Ga0187810_10411667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300018012|Ga0187810_10519039 | Not Available | 510 | Open in IMG/M |
| 3300018032|Ga0187788_10556539 | Not Available | 502 | Open in IMG/M |
| 3300020580|Ga0210403_11067623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300021181|Ga0210388_11226832 | Not Available | 635 | Open in IMG/M |
| 3300021402|Ga0210385_11026417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
| 3300021403|Ga0210397_10980828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 655 | Open in IMG/M |
| 3300021404|Ga0210389_10549325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 908 | Open in IMG/M |
| 3300021406|Ga0210386_11253229 | Not Available | 625 | Open in IMG/M |
| 3300021477|Ga0210398_10447866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1052 | Open in IMG/M |
| 3300021479|Ga0210410_10751472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 859 | Open in IMG/M |
| 3300021559|Ga0210409_11562131 | Not Available | 536 | Open in IMG/M |
| 3300024288|Ga0179589_10028011 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300025527|Ga0208714_1007418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces griseochromogenes | 2919 | Open in IMG/M |
| 3300025898|Ga0207692_10050900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2097 | Open in IMG/M |
| 3300025898|Ga0207692_10215736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1135 | Open in IMG/M |
| 3300025910|Ga0207684_10083142 | All Organisms → cellular organisms → Bacteria | 2727 | Open in IMG/M |
| 3300025915|Ga0207693_10466058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer → Ktedonobacter racemifer DSM 44963 | 987 | Open in IMG/M |
| 3300025915|Ga0207693_11064991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
| 3300025916|Ga0207663_10040504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2832 | Open in IMG/M |
| 3300025916|Ga0207663_11090220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium pseudokansasii | 642 | Open in IMG/M |
| 3300025939|Ga0207665_10366036 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300026075|Ga0207708_11803910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300026088|Ga0207641_10376917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1358 | Open in IMG/M |
| 3300026551|Ga0209648_10699852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300026557|Ga0179587_10478548 | Not Available | 816 | Open in IMG/M |
| 3300027765|Ga0209073_10209878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces guanduensis | 743 | Open in IMG/M |
| 3300027787|Ga0209074_10091034 | Not Available | 1015 | Open in IMG/M |
| 3300027915|Ga0209069_10995958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus → Chthoniobacter flavus Ellin428 | 514 | Open in IMG/M |
| 3300028536|Ga0137415_11037911 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 632 | Open in IMG/M |
| 3300028879|Ga0302229_10401599 | Not Available | 609 | Open in IMG/M |
| 3300030509|Ga0302183_10231146 | Not Available | 720 | Open in IMG/M |
| 3300030743|Ga0265461_10019325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1905 | Open in IMG/M |
| 3300031027|Ga0302308_10843174 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031572|Ga0318515_10202370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1064 | Open in IMG/M |
| 3300031668|Ga0318542_10701750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
| 3300031708|Ga0310686_117159699 | Not Available | 505 | Open in IMG/M |
| 3300031713|Ga0318496_10685837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300031715|Ga0307476_10217352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinisilvae | 1390 | Open in IMG/M |
| 3300031765|Ga0318554_10288801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 933 | Open in IMG/M |
| 3300031768|Ga0318509_10604251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 611 | Open in IMG/M |
| 3300031770|Ga0318521_10387238 | Not Available | 832 | Open in IMG/M |
| 3300031770|Ga0318521_11045659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 501 | Open in IMG/M |
| 3300031778|Ga0318498_10539196 | Not Available | 512 | Open in IMG/M |
| 3300031805|Ga0318497_10292506 | Not Available | 907 | Open in IMG/M |
| 3300031823|Ga0307478_10666035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinisilvae | 871 | Open in IMG/M |
| 3300031897|Ga0318520_10884863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 562 | Open in IMG/M |
| 3300031912|Ga0306921_11551081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300032001|Ga0306922_11328712 | Not Available | 726 | Open in IMG/M |
| 3300032008|Ga0318562_10903155 | Not Available | 504 | Open in IMG/M |
| 3300032055|Ga0318575_10478046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300032059|Ga0318533_10156337 | Not Available | 1616 | Open in IMG/M |
| 3300032064|Ga0318510_10152764 | Not Available | 912 | Open in IMG/M |
| 3300032770|Ga0335085_10572958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer → Ktedonobacter racemifer DSM 44963 | 1275 | Open in IMG/M |
| 3300032805|Ga0335078_10596096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Phytoactinopolyspora → Phytoactinopolyspora endophytica | 1395 | Open in IMG/M |
| 3300032828|Ga0335080_10377408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1525 | Open in IMG/M |
| 3300032898|Ga0335072_10142173 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Rhodothermus | 2962 | Open in IMG/M |
| 3300032898|Ga0335072_10279499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1890 | Open in IMG/M |
| 3300033134|Ga0335073_10193789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2530 | Open in IMG/M |
| 3300033134|Ga0335073_11649158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.97% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.98% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.99% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.99% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_09037600 | 2170459010 | Grass Soil | RGQEQVTTGDVLRAVGQTRRTLTAELVAEFEQDIQDYARV |
| Ga0066388_1047027342 | 3300005332 | Tropical Forest Soil | RVMFEGGEQEVTTSDIRYAISKTRRTLTSELVAEFEQDIQDHARL* |
| Ga0070709_105056933 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | HGKELVTTDDIRHAISQTRRTLTPELVADFEQDITEYARK* |
| Ga0070709_107185733 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | HGKELVTTDDIRHAISQTRRTLTPELVADFEQDITEYARI* |
| Ga0070714_1009016322 | 3300005435 | Agricultural Soil | VLFEHGKEEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV* |
| Ga0070714_1013823432 | 3300005435 | Agricultural Soil | FEGGEQEVTTSDIRHAISKTRRTLTPELVAEFEQDIEDYARV* |
| Ga0070698_1019549651 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GDEEVTTGDIVHAIGQTRRTLTPELVAEFEQDIQDYARV* |
| Ga0070732_109808032 | 3300005542 | Surface Soil | ERVLFERGEEKVSTADVLCGIAETRRTLTPELVAEFEQDIQAYARV* |
| Ga0066656_110276271 | 3300006034 | Soil | FERVLFEHGKELVTTGDIRHAISQTRRTLTPELVADFEQDITEYARM* |
| Ga0075015_1002843411 | 3300006102 | Watersheds | AQLVFERVMFEHGAEETTTADIVHAISQTRRTLTSPLVSDFEQDIKDYARV* |
| Ga0073928_110657872 | 3300006893 | Iron-Sulfur Acid Spring | GEEEVTTGDILHAIGQTRRTLTPGLVAEFEQDIKDYARV* |
| Ga0079219_124221192 | 3300006954 | Agricultural Soil | VIFTLMTDDIRHAISQTRRTLTPELVADFEQDITEYARI* |
| Ga0066793_101682612 | 3300009029 | Prmafrost Soil | MFEGGEQEVTTSDIRHAIGKTRRTLTPELVAEFEQDIEDYSRA* |
| Ga0116218_12438122 | 3300009522 | Peatlands Soil | EAATADIMHAIGQTRRTLTPELVAEFEQDIQDHARV* |
| Ga0126374_113792281 | 3300009792 | Tropical Forest Soil | DQAPSRSRPSAGPEPEEASTADLVHAISQTRRTLTPELAAELEQDIQDHARV* |
| Ga0134066_103640212 | 3300010364 | Grasslands Soil | EHGKELVTTGDIRHAISQTRRTLTPELVAEFEQDITEYARI* |
| Ga0126381_1011093401 | 3300010376 | Tropical Forest Soil | HGEELTTTADVVRGIGQTRRTLTTEMVAQFEQDIKDYARL* |
| Ga0126381_1043687231 | 3300010376 | Tropical Forest Soil | FERVLFERGAEEVTTEDVRHAIDQTRRTLTAELVAEFEQDIQDHARV* |
| Ga0136449_1034176581 | 3300010379 | Peatlands Soil | RTAQLAFERVLFEHGTEEVTTGDVLHAIGQTRRTLTAEVVAQFEQDILDYARV* |
| Ga0126383_124236602 | 3300010398 | Tropical Forest Soil | RPSAGPEPEEATTADLVHAISQTRRTLTPELAAELEQDIQDHARV* |
| Ga0137365_111197431 | 3300012201 | Vadose Zone Soil | VLFEHGKELVTTGDIRHAISQTRRTLTSELVAEFEQDITEYARM* |
| Ga0137381_108415692 | 3300012207 | Vadose Zone Soil | TTADVLRGIAETRRTLTPELVAEFEQDIQAYARV* |
| Ga0137386_102469461 | 3300012351 | Vadose Zone Soil | EEATTADIVHAIGQTRRTLTPELVAEFEQDIQDHARV* |
| Ga0137390_100866611 | 3300012363 | Vadose Zone Soil | GEELTSTPDVLRGLAETRRTLTPETVAEFEQDIKDYSRL* |
| Ga0137398_107189133 | 3300012683 | Vadose Zone Soil | LAFERVLFEHGKELVTTGDIRHAISQTRRTLTPELVAEFEQDITEYARMLGLGTSWLAE* |
| Ga0137416_108953341 | 3300012927 | Vadose Zone Soil | RVLFEHGKELVTTGDIRHAISQTRRTLTAEVVAEFEQDITEYARMLGLGTSWLAE* |
| Ga0157375_107085173 | 3300013308 | Miscanthus Rhizosphere | FERVLFERGKELVTTGDIRHAISQTRRTLTPELVADFEQDITEYARI* |
| Ga0134081_104248192 | 3300014150 | Grasslands Soil | LFEHGKELVTTGDIRHAISQTRRTLTPELVAEFEQDITEYARI* |
| Ga0137409_103193391 | 3300015245 | Vadose Zone Soil | KEVVTTGDIRHAISQTRRTLTPELVAEFEQDITEYARM* |
| Ga0132258_103424454 | 3300015371 | Arabidopsis Rhizosphere | GKELVTTDDIRHAISQTRRTLTPELVADFEQDITEYARI* |
| Ga0182036_109234531 | 3300016270 | Soil | EAVTTADVLQGIGQTRRTLTPELVAEFEQDIQAYARV |
| Ga0182036_114762442 | 3300016270 | Soil | VLFERGKEEVTTADVLRGITETRRTLTPEAVTEFEQDIQAYARV |
| Ga0182035_111123452 | 3300016341 | Soil | VLFERGKDEVTTADVLRGIAETRRTLTAEVVAEFEQDIQAYARV |
| Ga0182032_109367743 | 3300016357 | Soil | EHGTEQAATADIVHAIGQTRPTLTAELVTEFEQDIKDYARV |
| Ga0182040_114160161 | 3300016387 | Soil | HGTEQAATADIVHAIGQTRPTLTAELVTEFEQDIKDYARV |
| Ga0187820_10555701 | 3300017924 | Freshwater Sediment | AARRTAQLVFERVMFERGADQAATPDIEHAISQTRRTLTDELVTDFEQDIKDYARV |
| Ga0187807_12989311 | 3300017926 | Freshwater Sediment | GAEQAATADIVHAISQTRRTLTADLVADFEQDIKHYGRV |
| Ga0187808_102182191 | 3300017942 | Freshwater Sediment | LAFERVLFEGGGEEVATGDILHAIGQTRRTLTPELVSEFEQDIQDYARV |
| Ga0187778_102241191 | 3300017961 | Tropical Peatland | MFDHGGELAATADIVHAIGQTRRTLTKEPVTEFEQDINDYARV |
| Ga0187816_105831741 | 3300017995 | Freshwater Sediment | GEEQVTTDDVRKAIAMTRRTLTPELVAEFEQDIEDYARA |
| Ga0187815_103905441 | 3300018001 | Freshwater Sediment | GADQAATPDIEHAISQTRRTLTDELVTDFEQDIKDYARV |
| Ga0187810_104116671 | 3300018012 | Freshwater Sediment | GGGEEVATADILHAIGQTRRTLTPELVSEFEQDIQDYARV |
| Ga0187810_105190392 | 3300018012 | Freshwater Sediment | EVATADILHAIGQTRRTLTPELVSEFEQDIQDYARV |
| Ga0187788_105565392 | 3300018032 | Tropical Peatland | RGEEEVTTGDILHAIGQTRRTLTPELVAEFEQDIEDYARV |
| Ga0210403_110676232 | 3300020580 | Soil | VLFQRGEEQVTTGDVLRAVGQTRRTLTAELVKEFEQDIQNYARV |
| Ga0210388_112268322 | 3300021181 | Soil | ERGAEEATTADIVHGIGQTRRTLTPELVAEFEQDIQDHARV |
| Ga0210385_110264172 | 3300021402 | Soil | LFERGEEQVTMTDIRQAIAKTRRTLTPELVADFEQDIEDYARV |
| Ga0210397_109808281 | 3300021403 | Soil | QVTTGDVLRAVGQTRRTLTAELVAEFEQDIQDYARV |
| Ga0210389_105493251 | 3300021404 | Soil | VTTGDVLRAVGQTRRTLTPELVAEFEQDIQAYARV |
| Ga0210386_112532292 | 3300021406 | Soil | FERGAEEATTADIVHGIGQTRRTLTPELVAEFEQDIQDHARV |
| Ga0210398_104478661 | 3300021477 | Soil | QRGEEQVTTGDVLRAVGQTRRTLTAELVAEFEQDIQDYARV |
| Ga0210410_107514721 | 3300021479 | Soil | HGQEQVTTGDVLRAVGQTRRTLTPELVAEFEQDIQAYARV |
| Ga0210409_115621311 | 3300021559 | Soil | ERVMFERGAEEATTADIVHGIGQTRRTLTPELVAEFEQDIQDHARV |
| Ga0179589_100280111 | 3300024288 | Vadose Zone Soil | GKELVTTGDIRHAISHTRRTLTPELVAEFEQDITEYARM |
| Ga0208714_10074181 | 3300025527 | Arctic Peat Soil | ERGAEEATTADIMHAIGQTRRTLTPELVAEFEQDIQDHARV |
| Ga0207692_100509004 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GKEEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV |
| Ga0207692_102157361 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RGEEQVTTGDVLRAVGQTRRTLTAELVDEFEQDIQDYARV |
| Ga0207684_100831423 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VFIDEVEEILCGIAETRRTLTPELVVEFEQDIQAYARV |
| Ga0207693_104660582 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LFEHGKEEVTTADVLQGIAETRRTLTAELVTDFEQDIEAYARV |
| Ga0207693_110649911 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV |
| Ga0207663_100405041 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ERVLFEHGKEEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV |
| Ga0207663_110902201 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | HGKEEVTTADVLRGIAETRRTLTAELVADFEQDIEAYARV |
| Ga0207665_103660363 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTADVLQGIAETRRTLTAELVADFEQDIKDYARV |
| Ga0207708_118039102 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | KELVTTDDIRHAISQTRRTLTPELVADFEQDITEYARI |
| Ga0207641_103769173 | 3300026088 | Switchgrass Rhizosphere | GKEEVTTADVLAGIAETRRTLTAELVADFEQDIKDYARV |
| Ga0209648_106998522 | 3300026551 | Grasslands Soil | QDLTTTTDVLRGIAQTRRTLTPEMVAEFEQDIQDYARL |
| Ga0179587_104785481 | 3300026557 | Vadose Zone Soil | QVTTGDVLRAVGQTRRTLTPELVAEFEQDIQAYARV |
| Ga0209073_102098781 | 3300027765 | Agricultural Soil | AFERVLFEHGKEEVTTADVLQGIAETRRTLTAELVADFEQDIKDYARV |
| Ga0209074_100910341 | 3300027787 | Agricultural Soil | VIFTLMTDDIRHAISQTRRTLTPELVADFEQDITEYARI |
| Ga0209069_109959581 | 3300027915 | Watersheds | MFEHGAEEATTADIAHAISQTRRTLTPELVAEFEQDIQNYARV |
| Ga0137415_110379111 | 3300028536 | Vadose Zone Soil | RVLFEHGKELVTTGDIRHAISQTRRTLTAEVVAEFEQDITEYARMLGLGTSWLAE |
| Ga0302229_104015992 | 3300028879 | Palsa | LFEHGDEELTTADILRAIGQTRRTLTTELVSEFEQDIHDYARV |
| Ga0302183_102311462 | 3300030509 | Palsa | QGDEELTSGDILRAIGQTRRTLTTELVSEFEQDILDYARV |
| Ga0265461_100193255 | 3300030743 | Soil | FERVLFEHGDEEVTTGDVLHAIGQTRRTLTAELVAEFEQDILDYARV |
| Ga0302308_108431741 | 3300031027 | Palsa | VTTGDVLHAVGQTRRTLTLELVTEFEQDIQDYARV |
| Ga0318515_102023701 | 3300031572 | Soil | RVLFERGEEEVTTADVLHGIGQTRRTLTPELVAEFEQDIQAYARV |
| Ga0318542_107017501 | 3300031668 | Soil | VTTSDILHAIGQTRRTLTPELVAEFEQDIQDYARI |
| Ga0310686_1171596992 | 3300031708 | Soil | RVLFEHGDEEVTTGDVLHAIGQTRRTLTTELVAEFEQDILDYSRV |
| Ga0318496_106858371 | 3300031713 | Soil | GEEEVTTADVLHGIGQTRRTLTPELVAEFEQDIQAYARV |
| Ga0307476_102173521 | 3300031715 | Hardwood Forest Soil | VLFEHGEEQVTTGDVLRAVGLTRRTLTPELVAEFEQDIQAYARV |
| Ga0318554_102888011 | 3300031765 | Soil | GAEEATTADLVHAIGQTRRTLTPQLVAEFEQDIQDYARV |
| Ga0318509_106042512 | 3300031768 | Soil | FEGGGEQVTTGDVLHAIGQTRRTLTPELVAEFEQDIQDYARV |
| Ga0318521_103872381 | 3300031770 | Soil | LNSSGVLFEHGDEAVTTGDVLDPIGQTRRTPTPELMAEFEQDIHDYARV |
| Ga0318521_110456591 | 3300031770 | Soil | VRRVLFERGKEEVTTADVLRGITETRRTLTPEAVAEFEQDIQAFARI |
| Ga0318498_105391962 | 3300031778 | Soil | LFEGGGEEVATGDVLHAIGQTRRTLTPELVAEFEQDIQDYARV |
| Ga0318497_102925062 | 3300031805 | Soil | EVTTGDILHAIGQTRRTLTPELVAEFEQDIQDYARV |
| Ga0307478_106660351 | 3300031823 | Hardwood Forest Soil | EEQVTTGDVLRAVGLTRRTLTPELVAEFEQDIQAYARV |
| Ga0318520_108848632 | 3300031897 | Soil | HWWQSRRRGGEDVTTSDILHAIGQTRRTLTPELVAEFEQDIQDYARI |
| Ga0306921_115510812 | 3300031912 | Soil | GHWWQSRRRGGEDVTTSDILHAIGQTRRTLTPELVAEFEQDIQDYARI |
| Ga0306922_113287121 | 3300032001 | Soil | RVLFEGGGEEVATGDVLHAIGQTRRTLTPELVAEFEQDIQDYARV |
| Ga0318562_109031552 | 3300032008 | Soil | GAEEATTADLVHAIGQTRRTLTPELVAEFEQDIQDYARV |
| Ga0318575_104780462 | 3300032055 | Soil | RVLFEGGGEEVTTGDVLHAIGQTRRTLTPELVAEFEQDITDYARV |
| Ga0318533_101563371 | 3300032059 | Soil | FEGGEQEVTTSDVRHAISKTRRTLTPELVAKFEQDIQDHARV |
| Ga0318510_101527642 | 3300032064 | Soil | QLAFERVMFEGGEQEVTTSDVRHAISKTRRTLTPELVAKFEQDIQDHARV |
| Ga0335085_105729581 | 3300032770 | Soil | VTTADVLQGIAETRRTLTAELVADFEQDIEDYARV |
| Ga0335078_105960965 | 3300032805 | Soil | ERVLFERGDEDVTTADVLEGIAQTRRTLTPELVAEFEQDIQAYARV |
| Ga0335080_103774083 | 3300032828 | Soil | QLAFEQVLFEGGGEEVATGDVLHAIGQTRRTLTPELVSEFEQDIQDYARV |
| Ga0335072_101421731 | 3300032898 | Soil | VTTGDIRHAISQTRRTLTAEVVADFEQDITEYARI |
| Ga0335072_102794995 | 3300032898 | Soil | LFERGEQQVTTDDVLHAVGQTRRTLTAELVADFEQDIQDYARV |
| Ga0335073_101937891 | 3300033134 | Soil | DVTTADVLEGIAQTRRTLTPELVAEFEQDIQAYARV |
| Ga0335073_116491581 | 3300033134 | Soil | AETATTADVLAGLSQTRRTLTPEMVTQFEQDISSYARV |
| ⦗Top⦘ |