Metagenome Family F102659

Overview

Basic Information

• Family ID: F102659
• Family Type: Metagenome
• Number of Sequences: 101
• Average Sequence Length: 42 residues
• Representative Sequence: MQRRVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRLN
• Number of Associated Samples: 18
• Number of Associated Scaffolds: 101

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 37.76 %
• % of genes near scaffold ends (potentially truncated): 85.15 %
• % of genes from short scaffolds (< 2000 bps): 74.26 %
• Associated GOLD sequencing projects: 13
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (54.455 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont (79.208 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 58.33%
  β-sheet: 0.00%
  Coil/Unstructured: 41.67%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 101 Family Scaffolds
PF00001	7tm_1	2.97
PF00743	FMO-like	0.99
PF00078	RVT_1	0.99
PF00071	Ras	0.99
PF12874	zf-met	0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 101 Family Scaffolds
COG2072	Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD	Inorganic ion transport and metabolism [P]	0.99

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
All Organisms	root	All Organisms	45.54 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
cellular organisms	root	All Organisms → cellular organisms	45.54 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	43.56 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.98 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	42.57 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.98 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	37.62 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.98 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	37.62 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.98 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	37.62 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	1.98 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	24.75 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	12.87 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	1.98 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	24.75 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	12.87 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	1.98 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	24.75 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	12.87 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	1.98 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	24.75 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	12.87 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	1.98 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	24.75 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	12.87 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	24.75 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	12.87 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	24.75 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	12.87 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	24.75 %
Actinopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii	12.87 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	24.75 %
Cladistia	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Actinopteri	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri	0.99 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	24.75 %
Polypteriformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Neopterygii	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii	0.99 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	24.75 %
Polypteridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Holostei	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei	0.99 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	23.76 %
Polypterus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Semionotiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes	0.99 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	23.76 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Lepisosteidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes → Lepisosteidae	0.99 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	23.76 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Atractosteus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes → Lepisosteidae → Atractosteus	0.99 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	23.76 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Atractosteus spatula	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes → Lepisosteidae → Atractosteus → Atractosteus spatula	0.99 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	23.76 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Atractosteus spatula	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes → Lepisosteidae → Atractosteus → Atractosteus spatula	0.99 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	23.76 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Atractosteus spatula	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes → Lepisosteidae → Atractosteus → Atractosteus spatula	0.99 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	23.76 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Atractosteus spatula	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes → Lepisosteidae → Atractosteus → Atractosteus spatula	0.99 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	23.76 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Atractosteus spatula	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes → Lepisosteidae → Atractosteus → Atractosteus spatula	0.99 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.46 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	23.76 %
Polypterus senegalus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	11.88 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.98 %
Atractosteus spatula	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes → Lepisosteidae → Atractosteus → Atractosteus spatula	0.99 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001744|JGI24669J20092_10046366	Not Available	823
3300003906|JGI26667J51740_10153355	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	648
3300004626|Ga0066188_1036351	Not Available	1498
3300004626|Ga0066188_1067966	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1198
3300004626|Ga0066188_1072913	Not Available	1165
3300004626|Ga0066188_1145138	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	851
3300004626|Ga0066188_1147809	Not Available	843
3300004626|Ga0066188_1167451	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	787
3300004626|Ga0066188_1202415	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	704
3300004626|Ga0066188_1223252	All Organisms → cellular organisms → Eukaryota → Opisthokonta	662
3300004626|Ga0066188_1267898	Not Available	586
3300004630|Ga0049105_1024635	Not Available	4278
3300004630|Ga0049105_1335803	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	610
3300004630|Ga0049105_1339448	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	601
3300004630|Ga0049105_1345927	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	586
3300005170|Ga0071327_1017757	Not Available	4558
3300005170|Ga0071327_1172801	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1246
3300005170|Ga0071327_1245919	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	874
3300005170|Ga0071327_1254630	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	840
3300005968|Ga0056130_1003101	Not Available	4718
3300005968|Ga0056130_1018306	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2882
3300005968|Ga0056130_1044748	Not Available	2067
3300005968|Ga0056130_1101748	Not Available	1375
3300005968|Ga0056130_1134528	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1152
3300005968|Ga0056130_1134689	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1151
3300005968|Ga0056130_1153209	Not Available	1053
3300005968|Ga0056130_1186295	Not Available	906
3300005968|Ga0056130_1216245	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	798
3300005968|Ga0056130_1219502	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	787
3300005968|Ga0056130_1221703	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	780
3300005968|Ga0056130_1235350	Not Available	738
3300005968|Ga0056130_1235789	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	737
3300005968|Ga0056130_1274501	Not Available	635
3300005968|Ga0056130_1307329	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	565
3300005978|Ga0056129_1013887	Not Available	4320
3300005978|Ga0056129_1013959	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	4311
3300005978|Ga0056129_1019158	Not Available	3839
3300005978|Ga0056129_1036398	Not Available	2938
3300005978|Ga0056129_1112952	Not Available	1512
3300005978|Ga0056129_1127944	Not Available	1372
3300005978|Ga0056129_1213668	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	844
3300005978|Ga0056129_1248836	Not Available	709
3300005978|Ga0056129_1260052	Not Available	672
3300005978|Ga0056129_1279172	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	616
3300005978|Ga0056129_1280550	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	612
3300005978|Ga0056129_1282664	Not Available	607
3300005978|Ga0056129_1297110	Not Available	570
3300005978|Ga0056129_1321858	Not Available	516
3300005978|Ga0056129_1326124	Not Available	508
3300005984|Ga0056126_10049831	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1947
3300006000|Ga0056123_1295445	Not Available	640
3300006912|Ga0056114_1006443	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	7238
3300006912|Ga0056114_1008589	Not Available	6583
3300006912|Ga0056114_1013765	Not Available	5585
3300006912|Ga0056114_1038694	Not Available	3487
3300006912|Ga0056114_1058009	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2737
3300006912|Ga0056114_1060473	All Organisms → cellular organisms → Eukaryota	2661
3300006912|Ga0056114_1062541	Not Available	2602
3300006912|Ga0056114_1065380	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Holostei → Semionotiformes → Lepisosteidae → Atractosteus → Atractosteus spatula	2523
3300006912|Ga0056114_1077271	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	2234
3300006912|Ga0056114_1105989	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1706
3300006912|Ga0056114_1116839	Not Available	1555
3300006912|Ga0056114_1120380	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	1510
3300006912|Ga0056114_1125002	Not Available	1453
3300006912|Ga0056114_1127761	Not Available	1420
3300006912|Ga0056114_1128911	Not Available	1407
3300006912|Ga0056114_1170210	Not Available	1021
3300006912|Ga0056114_1178976	Not Available	959
3300006912|Ga0056114_1184926	Not Available	919
3300006912|Ga0056114_1201396	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	821
3300006912|Ga0056114_1243700	Not Available	633
3300006912|Ga0056114_1258924	Not Available	584
3300006912|Ga0056114_1270244	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	553
3300006912|Ga0056114_1283322	Not Available	522
3300006912|Ga0056114_1288533	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	511
3300008215|Ga0056108_1334105	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	834
3300027044|Ga0209785_1072622	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	509
3300027289|Ga0209787_1085759	Not Available	1277
3300027289|Ga0209787_1126124	Not Available	1022
3300027289|Ga0209787_1154829	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	892
3300027289|Ga0209787_1167135	Not Available	843
3300027289|Ga0209787_1174848	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	813
3300027289|Ga0209787_1196619	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	735
3300027289|Ga0209787_1232775	Not Available	629
3300027289|Ga0209787_1249680	Not Available	586
3300027289|Ga0209787_1274404	Not Available	528
3300027392|Ga0209680_1002813	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6649
3300027392|Ga0209680_1014639	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	3968
3300027392|Ga0209680_1015580	Not Available	3883
3300027392|Ga0209680_1116682	Not Available	1378
3300027392|Ga0209680_1231690	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	674
3300027392|Ga0209680_1251097	Not Available	601
3300027392|Ga0209680_1255636	Not Available	584
3300027549|Ga0209458_1009311	Not Available	3295
3300027549|Ga0209458_1163632	All Organisms → cellular organisms → Eukaryota → Opisthokonta	933
3300027550|Ga0209255_1251195	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	849
3300027585|Ga0209150_1019459	Not Available	2313
3300027585|Ga0209150_1068281	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Cladistia → Polypteriformes → Polypteridae → Polypterus → Polypterus senegalus	1482

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	79.21%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	20.79%

Subtype

Habitat	Taxonomy	Distribution
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	79.21%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	20.79%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	79.21%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	20.79%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated
3300001744	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2	Host-Associated
3300003906	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2	Host-Associated
3300004626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.2	Host-Associated
3300004630	Worm MetaG Olavius vacuus BAHAMAS.1	Host-Associated
3300005170	Worm MetaG Olavius vacuus BAHAMAS.1 (version 1)	Host-Associated
3300005968	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2	Host-Associated
3300005978	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1	Host-Associated
3300005984	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus manae LIZARD ISLAND	Host-Associated
3300006000	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 3 HERON ISLAND	Host-Associated
3300006912	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae HERON ISLAND.1	Host-Associated
3300008215	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1 BERMUDA.1	Host-Associated
3300027044	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus leukodermatus Group 1 BERMUDA.2 (SPAdes)	Host-Associated
3300027289	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.2 (SPAdes)	Host-Associated
3300027392	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius loisae LIZARD ISLAND.1 (SPAdes)	Host-Associated
3300027549	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Inanidrilus manae LIZARD ISLAND (SPAdes)	Host-Associated
3300027550	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius vacuus BAHAMAS.2 (SPAdes)	Host-Associated
3300027585	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24671J20093_100460622	3300001741	Marine Gutless Worms Symbiont	MQHRVYHKKIHNVGELKRRLIDVWCGLEQSIFDEAIVI*
JGI24669J20092_100463661	3300001744	Marine Gutless Worms Symbiont	MQRRVYQTKIHTIDELNQRLIEVSCGLEQSTVDMAVDQWRRKLRACV
JGI26667J51740_101533551	3300003906	Marine Gutless Worms Symbiont	MQRRVYETKIHTIDELKQRLIEVWCNLEQSTVDMAIEQWRGRLR
Ga0066188_10363511	3300004626	Marine Gutless Worms Symbiont	MRRRVYKRNIHTIDELKQRLIEIWCGFEQSTVDMAIDQWRKKT*
Ga0066188_10679662	3300004626	Marine Gutless Worms Symbiont	MQHHVYQRKIHTIDELKQRLIEVWYGLEQSTVNMAIDQWH*
Ga0066188_10729133	3300004626	Marine Gutless Worms Symbiont	EIWAVMQRRVYQRKIHTIDELKQRLIEVWCGLEQSTVDMAIDQWCKRFN*
Ga0066188_11451381	3300004626	Marine Gutless Worms Symbiont	MHQRGVYQRKIHTIDELKQRLIEVWCGFEQSTVDMAVDQWRKRLR
Ga0066188_11478091	3300004626	Marine Gutless Worms Symbiont	MQHRVYHRKIHTIDELKQRLIEVWCGLEQLTVNMAIDQWRKR
Ga0066188_11674511	3300004626	Marine Gutless Worms Symbiont	MQRRVYQRKIHTIDELKQRLIEVWSGLEQSTVNMAIDQWRKRLN*
Ga0066188_12024151	3300004626	Marine Gutless Worms Symbiont	MQRRVYQRKIHTINELKQRLIEVWCRLEQSTVNMAIGQWRKRLN*
Ga0066188_12232521	3300004626	Marine Gutless Worms Symbiont	MQRHVYQRKIHTINELKQRLIEVWCGLEQSTVNMTIDQWRKKLN*
Ga0066188_12678982	3300004626	Marine Gutless Worms Symbiont	RVYQRKIHTINELKQRLIEVWCGLEQSTVNMAIDQYRKRLN*
Ga0049105_10246351	3300004630	Marine Gutless Worms Symbiont	MHHRVYKTKIHTIDELKQRLIEVWCGLEQSTVDMAIEQWRGR
Ga0049105_13358032	3300004630	Marine Gutless Worms Symbiont	MQRHVYKTKIHTIDELKQRLIEVWCGLKQSTVDMAIEQWRGRLTSLC
Ga0049105_13394483	3300004630	Marine Gutless Worms Symbiont	MQHRVYKTKIHTIDELKQRLIEVWCGLEQSTVDMAIEQWRGR
Ga0049105_13459271	3300004630	Marine Gutless Worms Symbiont	MQRRVYKTKIHIIDDLKQRLIEVWCNLEQSTVDMAIEQWRGRL*
Ga0071327_10177571	3300005170	Marine Gutless Worms Symbiont	RVYKTKIHTIDELKQRLIEVWCGLKQSTVDMAIEQWRGRLG*
Ga0071327_11728011	3300005170	Marine Gutless Worms Symbiont	MQHRVYKTKIHTIDELKQRLIEVWCGLEQSTVDMAIEQWRGRLR
Ga0071327_12459192	3300005170	Marine Gutless Worms Symbiont	MHCRVYKTKIHTIDELKQRLIEVWCGLKQSTVDMAIEQWRGR
Ga0071327_12546301	3300005170	Marine Gutless Worms Symbiont	MQRHVYKMKIHTIDELKQRLIEVWCGLEQSTVDMAIEQWRGRLRACV
Ga0056130_10031011	3300005968	Marine Gutless Worms Symbiont	QRKIHTINEMKQRLIEVWCGLEQSTVNMAIDQSCKRLN*
Ga0056130_10183061	3300005968	Marine Gutless Worms Symbiont	MHQHGVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAVDQWRKRL
Ga0056130_10447485	3300005968	Marine Gutless Worms Symbiont	MQRRVYQRKIHTINELKQRLIEVWCGLEQLTVNMAIDQWRKRLN*
Ga0056130_11017482	3300005968	Marine Gutless Worms Symbiont	HVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRHN*
Ga0056130_11345282	3300005968	Marine Gutless Worms Symbiont	MQRHVYQRKIHTLDELKQRLIEVWCGLEQSTVNMAIDQWRKR
Ga0056130_11346891	3300005968	Marine Gutless Worms Symbiont	MQRRVYQKKIHTINELKQRLIEVWCGLEQSTVNMAIDQ
Ga0056130_11532091	3300005968	Marine Gutless Worms Symbiont	HTINELKQRLIEVWCGLEQSTVNMAIDQWRKRLN*
Ga0056130_11862952	3300005968	Marine Gutless Worms Symbiont	MHHRGVYQRKIHTIDELKQRLIEVWCGLEQSTVDMAVD
Ga0056130_12162451	3300005968	Marine Gutless Worms Symbiont	MHQRGVYQKKFHTVDELKQRLIEVWCGLEQSTVDMAVDQWRKRLR
Ga0056130_12195022	3300005968	Marine Gutless Worms Symbiont	MHQRGVYKRKIHTIDELKQRLIEVWCGLEQSTVDMAVDQW
Ga0056130_12217031	3300005968	Marine Gutless Worms Symbiont	MHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVDM
Ga0056130_12353502	3300005968	Marine Gutless Worms Symbiont	VMQRRVYQRKIHTIDELKQRLTEVWCGLEQSTVNMAVDQWCKRLN*
Ga0056130_12357891	3300005968	Marine Gutless Worms Symbiont	MQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRL
Ga0056130_12745011	3300005968	Marine Gutless Worms Symbiont	WAVMHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAVDQWP*
Ga0056130_13073291	3300005968	Marine Gutless Worms Symbiont	MHQRGVYQRKIHTIDELQQRLIEVWCGLEQSTVDMAVDQWRKRL
Ga0056129_10138872	3300005978	Marine Gutless Worms Symbiont	MQRHVNQRKIHTIDKLKQRLIEVWCGLEQSTVNMAIDQWCKKLN*
Ga0056129_10139597	3300005978	Marine Gutless Worms Symbiont	MQRRVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRLN*
Ga0056129_101915811	3300005978	Marine Gutless Worms Symbiont	DYQIWAVMHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVHMAVDQ*
Ga0056129_10363985	3300005978	Marine Gutless Worms Symbiont	YQRKIHTINELKQRLIEVWCGLEQSTVNMAIDQWRKRLN*
Ga0056129_11129521	3300005978	Marine Gutless Worms Symbiont	MHQRGVYQRKIHTIDELKQRLIEVWCGFEQSTVDMAV
Ga0056129_11279441	3300005978	Marine Gutless Worms Symbiont	VYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRHN*
Ga0056129_12136682	3300005978	Marine Gutless Worms Symbiont	MQRRVYHKKIRAIVELKQRLIEVWCSLEQSTVNMAIAQWRKRLN*
Ga0056129_12488361	3300005978	Marine Gutless Worms Symbiont	DYQIWAVMRQRGVYQRKIHTIDELKQRLIEVWCGLEQSTV*
Ga0056129_12600521	3300005978	Marine Gutless Worms Symbiont	MHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVDMAVD
Ga0056129_12791721	3300005978	Marine Gutless Worms Symbiont	MHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVDMAVDQWCK
Ga0056129_12805502	3300005978	Marine Gutless Worms Symbiont	MQRKIRTIDELKQRLIEVWCGLEQSTVDMAIDHWRKRLRAC
Ga0056129_12826641	3300005978	Marine Gutless Worms Symbiont	VYQRKIHTIDELKQRLIKVWCGLEQSTVNMAVDQWHKRLN*
Ga0056129_12971101	3300005978	Marine Gutless Worms Symbiont	MHQHGVYQRKIHTIDELKQRLIEVWCSLEQSTVDMAVDQWRKRLRA
Ga0056129_13218582	3300005978	Marine Gutless Worms Symbiont	RHVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRVN*
Ga0056129_13261241	3300005978	Marine Gutless Worms Symbiont	VYQRKIHTINELKQRLIEVWCGLEQSTVNMAIDQWHKRLD*
Ga0056126_100093004	3300005984	Marine Gutless Worms Symbiont	VYRSKIHTIDELKQRLIEVWCGLEQSIVDMAIDSWH*
Ga0056126_100498311	3300005984	Marine Gutless Worms Symbiont	MQRHVYQRKIYIIDELKQKLIEVWCGLEQSTVDMAIDQWHKRLRACVR
Ga0056123_12954452	3300006000	Marine Gutless Worms Symbiont	MQRRAYQRKIHTIDELKQRLIEVWCGLEQSTVDMAIDQWRKRL
Ga0056114_10064432	3300006912	Marine Gutless Worms Symbiont	MQRHVYQRKIRTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRLN*
Ga0056114_100858914	3300006912	Marine Gutless Worms Symbiont	VYQRKIHTINELKQRLIEVWCGLEQSTVNMAIDQWHKRLN*
Ga0056114_10137657	3300006912	Marine Gutless Worms Symbiont	DYEICDVMQRRVYQRKIHTIDELKQRLIEVWCGLKQSTVNMAIDQWRKRLN*
Ga0056114_10386941	3300006912	Marine Gutless Worms Symbiont	AVMQRHVYQRKIHTINELKQRLIEVWCGLEQSTVDMAIDQWHKRLN*
Ga0056114_10580091	3300006912	Marine Gutless Worms Symbiont	MQRHVYQRKIHTINELKQRLIEVWCGLEQSTVNMTID
Ga0056114_10604734	3300006912	Marine Gutless Worms Symbiont	QRKIHTINELKQRLIEVWCGLEQSTVDMAVDQWRKRLN*
Ga0056114_10625411	3300006912	Marine Gutless Worms Symbiont	MQRHVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAID*
Ga0056114_10653805	3300006912	Marine Gutless Worms Symbiont	IWAVMHQRGVYQRKIHTNDELKQRLVEVWCGLEQSTVDMAVDQWRKRLN*
Ga0056114_10772712	3300006912	Marine Gutless Worms Symbiont	MHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVDMA
Ga0056114_10967094	3300006912	Marine Gutless Worms Symbiont	VYQRKIHTIDELKHRLTELWCGLEQLTVDMAIDQWRKRLN*
Ga0056114_11059891	3300006912	Marine Gutless Worms Symbiont	MHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVDMAIDQWRKRLN
Ga0056114_11168393	3300006912	Marine Gutless Worms Symbiont	MQRHVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQ
Ga0056114_11203801	3300006912	Marine Gutless Worms Symbiont	MQRRVYQRKIHTIGELKQRLIEVWCGLEQSTVDMAVDHWRKRLRACVR
Ga0056114_11250021	3300006912	Marine Gutless Worms Symbiont	PVDYEIWAVMQRRVYQRKIHTIDELKQRLIEVWCGLEQSTVNVAIDQWCKRHN*
Ga0056114_11277611	3300006912	Marine Gutless Worms Symbiont	MQRLIYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQ
Ga0056114_11289112	3300006912	Marine Gutless Worms Symbiont	NPVDYQIWADMHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAVE*
Ga0056114_11702104	3300006912	Marine Gutless Worms Symbiont	CDVMQRRVYQRKIHTINELKQRLIEVWCGLEQSTVNMAIDLWRKRLN*
Ga0056114_11789764	3300006912	Marine Gutless Worms Symbiont	RRVYQRKIHTIDELKQRLIEVWCGLEQSTVNLAIDQWRKRLN*
Ga0056114_11849261	3300006912	Marine Gutless Worms Symbiont	RVYQRKIHTIDELKQRLIEVWCGLEQSTVAMAVDQWRKRLN*
Ga0056114_12013961	3300006912	Marine Gutless Worms Symbiont	VQRHVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWHK
Ga0056114_12437001	3300006912	Marine Gutless Worms Symbiont	VYQRKIHTIDELKQRLIEVWCGLEQSTVNMAVDQWHKRLN*
Ga0056114_12589242	3300006912	Marine Gutless Worms Symbiont	CDVMQRRVYQRKIHTINELKQRLIEVWCGLEQSTVNLAIDQWRKRLN*
Ga0056114_12702441	3300006912	Marine Gutless Worms Symbiont	MQHRVYHRKIHTIDELKQRLIEVWCGLEQLTVNMAIDQWRKRL
Ga0056114_12833221	3300006912	Marine Gutless Worms Symbiont	CDVMQRRVYQRKIHTINELKQRLIEVWCGLEQSTINMAIYQWRKRLN*
Ga0056114_12885331	3300006912	Marine Gutless Worms Symbiont	MHQRDVYQRKIHTIDELKQRLIEVWCGLEQSTVDMAVDQWRKRLR
Ga0056108_13341052	3300008215	Marine Gutless Worms Symbiont	MQHRVYKTKIHTIDELKQRLIEVWCGLEQSTVDMAIEQW
Ga0209785_10726222	3300027044	Marine Gutless Worms Symbiont	VMQRRVCKTKIHTIDELKQRLVEVWCGLEQSTVDMAIEQRRGRL
Ga0209787_10857591	3300027289	Marine Gutless Worms Symbiont	VYQRKIHTINELKQRLIEVWCGLEQSTVNMAIDQWRKRLN
Ga0209787_11261241	3300027289	Marine Gutless Worms Symbiont	MQRRVYQRKIHTINELKQRLIEVWCGLEPSTVDMPID
Ga0209787_11548291	3300027289	Marine Gutless Worms Symbiont	MQRRVYQRIIHTIDELKQRLIEVWCGLEQSTVNMAID
Ga0209787_11671351	3300027289	Marine Gutless Worms Symbiont	IEIWAVMQRRVYQRIIHTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRLN
Ga0209787_11748481	3300027289	Marine Gutless Worms Symbiont	MQRHVYQRKIHTIKELKQRLIEVWCGLEQSTVDMAVD
Ga0209787_11966192	3300027289	Marine Gutless Worms Symbiont	MQRRVYQRKIHTIDELKQRLIEVWCGLEQLSVDMAIDQWCKKHR
Ga0209787_12327751	3300027289	Marine Gutless Worms Symbiont	AVMHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAVDQWP
Ga0209787_12496801	3300027289	Marine Gutless Worms Symbiont	VYQRKIHTIDELKQRLIEVWCGLEQSTVDMAVDQWCKKT
Ga0209787_12744041	3300027289	Marine Gutless Worms Symbiont	QIWAVMHQRGVYQRKIHTIDELKQRLIEVWCGLEQSTVHMAVDQ
Ga0209680_10028133	3300027392	Marine Gutless Worms Symbiont	MQRRVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQ
Ga0209680_10146395	3300027392	Marine Gutless Worms Symbiont	MQRRVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRLN
Ga0209680_10155801	3300027392	Marine Gutless Worms Symbiont	KIHTINELKQRLIEVWCGLEQSTVNMAIDQWRKRLN
Ga0209680_11166821	3300027392	Marine Gutless Worms Symbiont	VYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWRKRHN
Ga0209680_12316901	3300027392	Marine Gutless Worms Symbiont	MWAVVQHRVYQRKIHTIDELKQRLIEVWCGLEQSTVNMAIDQWCKS
Ga0209680_12510971	3300027392	Marine Gutless Worms Symbiont	HVYQRKIHTIDELQQRLIEVWCGLEQSTVNMAVDQWRKRL
Ga0209680_12556361	3300027392	Marine Gutless Worms Symbiont	ICDVMQRRVYQRKIYTINELKQRLIEVWCGLEQSTVAMAVDQWRKRLN
Ga0209458_10093114	3300027549	Marine Gutless Worms Symbiont	MQRRVYQRKIHTIDELKQRLTEVFCGLEQLTSDMAI
Ga0209458_11636321	3300027549	Marine Gutless Worms Symbiont	MQRRAYQRKIHTIVELKQRPIEVWCGLEQLTSDMAIDQWRRRLRACVR
Ga0209255_12511951	3300027550	Marine Gutless Worms Symbiont	MQRRVYKTKIHTIDELKQRLIEVWCGLEQSTVDMAIEQWR
Ga0209150_10194591	3300027585	Marine Gutless Worms Symbiont	INHVYCEIWAVMQRRVYQRQIHTVDEVKGQRIDVWCGLQQTIFGEAIDQW
Ga0209150_10682811	3300027585	Marine Gutless Worms Symbiont	MQRRVYQTKIHTINELKQRLIEVWCSLQQSTVVMA