| Basic Information | |
|---|---|
| Family ID | F102622 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKRRWNAALQSLVLVRMGQELGTDSDLAQAVAHSIDFVLGTLARFLP |
| Number of Associated Samples | 55 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 95.00 % |
| % of genes near scaffold ends (potentially truncated) | 9.90 % |
| % of genes from short scaffolds (< 2000 bps) | 62.38 % |
| Associated GOLD sequencing projects | 49 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (74.257 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (33.663 % of family members) |
| Environment Ontology (ENVO) | Unclassified (81.188 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.218 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.67% β-sheet: 0.00% Coil/Unstructured: 45.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF03837 | RecT | 5.94 |
| PF00589 | Phage_integrase | 5.94 |
| PF02899 | Phage_int_SAM_1 | 4.95 |
| PF13495 | Phage_int_SAM_4 | 4.95 |
| PF01555 | N6_N4_Mtase | 3.96 |
| PF09250 | Prim-Pol | 2.97 |
| PF01726 | LexA_DNA_bind | 1.98 |
| PF04448 | DUF551 | 1.98 |
| PF12728 | HTH_17 | 1.98 |
| PF05866 | RusA | 1.98 |
| PF05136 | Phage_portal_2 | 0.99 |
| PF07120 | DUF1376 | 0.99 |
| PF00145 | DNA_methylase | 0.99 |
| PF13518 | HTH_28 | 0.99 |
| PF05135 | Phage_connect_1 | 0.99 |
| PF03354 | TerL_ATPase | 0.99 |
| PF10124 | Mu-like_gpT | 0.99 |
| PF11367 | DUF3168 | 0.99 |
| PF11922 | DUF3440 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 5.94 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 4.95 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 4.95 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.96 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.96 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.96 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 1.98 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.99 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.99 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.99 |
| COG5511 | Phage capsid protein | Mobilome: prophages, transposons [X] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 74.26 % |
| All Organisms | root | All Organisms | 25.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 33.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 28.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 6.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.94% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.97% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.97% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.98% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.99% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.99% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020544 | Freshwater microbial communities from Lake Mendota, WI - 04SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020552 | Freshwater microbial communities from Lake Mendota, WI - 06JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021349 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-6m | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1087746942 | 3300002408 | Freshwater | MNRYWNTALHSLLCVRLGQELGTTSELAQAVAHSIDFVLGSLARFLG* |
| B570J29032_1089285021 | 3300002408 | Freshwater | MKRHWNAAMKSLLLVRLGQELGTSSDLAQAIAHSIDFVLGTLARFLG* |
| B570J40625_10003829514 | 3300002835 | Freshwater | MQRQWNAALHSLLCVRLGQELGTASELAQTVAHCIDFLIGTLARLIA* |
| B570J40625_1001047624 | 3300002835 | Freshwater | MARIWNRLLEQLVLVRLGQELGTDSDLARAVAHSIDFALGTLARFLG* |
| B570J40625_1004615233 | 3300002835 | Freshwater | MQRRWNAALQSLVLVRLGQELGTDSSLAQTVAHAIDFAVGTLARFLP* |
| Ga0007791_100033981 | 3300004772 | Freshwater | MTRNWNAALQSLVLIRLGQELGTSSDLAQAIAHSIDALVHALAGALAR* |
| Ga0007796_101497783 | 3300004804 | Freshwater | MKRNWNAALQSLVLVRLGQELGTSSDLAQAIAHSIDALVHALA |
| Ga0068877_1000100034 | 3300005525 | Freshwater Lake | MPRTWNAAIHSLLCIRLGQELGTSSELAQTIAHSIDFAVGTLARILG* |
| Ga0049081_100744022 | 3300005581 | Freshwater Lentic | MKRYWNNALQSLVLVRMGQELGTDSDLAQAVAHSIDFVLGTLARFFS* |
| Ga0049081_102962871 | 3300005581 | Freshwater Lentic | MKRRWNAALQSLVLIRFGQELGTDSSLAQTVAHAIDFAVGTLARFLP* |
| Ga0079957_100250216 | 3300005805 | Lake | MKRRWNSALQALVLVRFGQELGTSSDTAQAVAHCIDFVLGTVARLVG* |
| Ga0075470_100019431 | 3300006030 | Aqueous | MARIWNRLLEQLVLVRLGQELGTDSELAQAIAGGIDFALGTLARFIG* |
| Ga0102978_11701223 | 3300007177 | Freshwater Lake | MGKRWNAALQSLVLVRLGQELGSDSSLARSVAAAIDCVLDLLRPFF* |
| Ga0114973_100785653 | 3300009068 | Freshwater Lake | MKRRLDAALQSLVLIRFGQELGTDSDLAQAVASVIDFAIGTISRLLT* |
| Ga0114973_101618421 | 3300009068 | Freshwater Lake | MRRRLDAALQSLVLIRFGQELGTDSDIAQAVAHGIDFVLGTLARFLG* |
| Ga0114973_101801101 | 3300009068 | Freshwater Lake | MKRRLDAALQSLVLIRLGQELGTDSDIAQAVAHGIDFVLGTLARFLG* |
| Ga0114973_102302463 | 3300009068 | Freshwater Lake | MRRRLNAALQSLVLIRLGQELGTDSDIAQAVAHGIDFVLGTLAKFLG* |
| Ga0114973_103884932 | 3300009068 | Freshwater Lake | MKRRIDAALQSLVLIRFGQELGTDSDLAQAVASAIDFAIGTISRLLT* |
| Ga0114973_104526841 | 3300009068 | Freshwater Lake | MKRRIDAALQSLVLIRFGQELGTDSDLAQAVASVIDFAIGTISRLLT* |
| Ga0114980_1000028952 | 3300009152 | Freshwater Lake | MPRTWNAAIHSLLCIRLGQELGTSSELAQTIAHSIDFVLGTLARFLG* |
| Ga0114980_101821951 | 3300009152 | Freshwater Lake | MKSHWKRCWNTLLHSLVCVRLGQELGTSSELAQAVAGSIDFVLKTLARFLG* |
| Ga0114980_102444442 | 3300009152 | Freshwater Lake | MTRRWNAALQSLVLVRLGQELGTDSSLAQTVAHAIDFAVGTLARFLP* |
| Ga0114963_100171384 | 3300009154 | Freshwater Lake | MKTHWKRCWNTLLHSLVCVRLGQELGTSSDLAQAVAHSIDFVLGTLSRFLG* |
| Ga0114963_100267632 | 3300009154 | Freshwater Lake | MTRTWNAAIHSLVCVRLGQELGTSSDLAQAIAHSIDFVLGILARFCG* |
| Ga0114963_101446662 | 3300009154 | Freshwater Lake | MTRRWNAALQSLVLVRLGQELGTSSDLAQAIAHSIDALLDSLARFLS* |
| Ga0114963_102334902 | 3300009154 | Freshwater Lake | MKRRWNAALQSLVLVRLGQELGCDSSLAQTVAHAIDFAVGTLARFLP* |
| Ga0114970_105454871 | 3300009163 | Freshwater Lake | GHTMKRRWNAALQSLVLVRLGQELGTDSSLAQNVAHGIDFVLGTLARFLS* |
| Ga0114970_105809221 | 3300009163 | Freshwater Lake | MKRRWNAALQSLVLVRLGQELGADSSLAQNVAHGIDFVLGTLARFLS* |
| Ga0114974_100997192 | 3300009183 | Freshwater Lake | MARIWNRLLEQLVLVRLGQELGADSDLAQAIAGGIDFALGTLARFIG* |
| Ga0114974_103179682 | 3300009183 | Freshwater Lake | MKSRWNAALNSLLCVRLGQELGTSSELAQAVAGGIDFVLGTLARFLG* |
| Ga0114976_101274171 | 3300009184 | Freshwater Lake | MTRRWNAALQSLVLVRLGQELGTDSSLAQAVAHAIDFAVGTLA |
| Ga0129333_102098492 | 3300010354 | Freshwater To Marine Saline Gradient | MARIWNRLLEQLVLVRLGQELGTDSDLARAIAHCIDFALGTLARFLG* |
| Ga0129333_106145752 | 3300010354 | Freshwater To Marine Saline Gradient | MTRHWNHAMHSLLLVRLGQELGTSSELAQAIAHGIDALVSAIARFVG* |
| Ga0129336_102636223 | 3300010370 | Freshwater To Marine Saline Gradient | MQRHWNAALHSLLCVRLGQELGTASELAQTVAHSIDFVIGTVARLFS* |
| Ga0129336_104556352 | 3300010370 | Freshwater To Marine Saline Gradient | MAREGHVMTRRYNTAIQSLLLVRLGQELGTSSDLAQAIAHGIDALVLAIARFAS* |
| Ga0133913_106379801 | 3300010885 | Freshwater Lake | MQRRWNAALQSLVLVRLGQELGTDSSLAQTVAHAIDFA |
| Ga0153800_10128432 | 3300011995 | Freshwater | MNWNAALQSLVLVRLGQDLGHDSKLARAIHNLIDLLVNVATGIF* |
| Ga0119951_10210535 | 3300012000 | Freshwater | MKHHWKRGWSSLLHSLVCVRLGQELGTSSDLAQAVAHSIDFVLGALARFLG* |
| Ga0119951_10779042 | 3300012000 | Freshwater | MARTWNAAIHSLVCVRLGQELGTSSDLAQAIAHSIDFVLGVLARFLG* |
| Ga0153799_10140982 | 3300012012 | Freshwater | MKRHWNNALQSLVLIRFGQELGTDSELAQAVAHSIDFVLSTLSRIFS* |
| Ga0177922_105682243 | 3300013372 | Freshwater | MKRRWNAALQSLVLVRLGQELGTSSDLAQAIAHSIDALVHALTGALAR* |
| Ga0177922_109182621 | 3300013372 | Freshwater | MKRHWNATLQSLVLVRFGQELGTDSDLAQAVAHSIDFVLGTLARFLP* |
| Ga0181343_11889102 | 3300017766 | Freshwater Lake | MKRRWNAALQSLVLVRLGQELGTSSDLAQAIAHSIDALLNSLARFLS |
| Ga0207193_10381592 | 3300020048 | Freshwater Lake Sediment | MKRQWNAAMKSLLLIRVGQELGTSSELAQTIAHSIDFILGTLARFFS |
| Ga0194035_11692981 | 3300020167 | Anoxic Zone Freshwater | MKRINWNAALQSLVLIRFGQELGTASDIAQAVAHSIDFVLGTLARFLA |
| Ga0208326_1000333 | 3300020494 | Freshwater | MKRQWNAAMKSLLLIRVGQELGTSSELAQTIAHSIDFVLGTLARFFS |
| Ga0207935_100031115 | 3300020516 | Freshwater | MQRQWNAALHSLLCVRLGQELGTASELAQTVAHCIDFLIGTLARLIA |
| Ga0207935_10107783 | 3300020516 | Freshwater | MARIWNRLLEQLVLVRLGQELGTDSDLARAVAHSIDFALGTLARFLG |
| Ga0207939_10069203 | 3300020536 | Freshwater | MKRHWNAAMKSLLLVRLGQELGTSSDLAQAIAHSIDFVLGTLARFLG |
| Ga0207937_10290152 | 3300020544 | Freshwater | MNRYWNTALHSLLCVRLGQELGTTSELAQAVAHSIDFVLGSLARFLG |
| Ga0207940_100043725 | 3300020552 | Freshwater | MTRRWNAALQSLVLVRLGQELGTSSDLAQAIAHSIDALVHALAGALAR |
| Ga0194052_10411112 | 3300021349 | Anoxic Zone Freshwater | MKRRWNAALQALVLVRLGQELGTDSELSQAVAHSIDFVLGTLARFLS |
| Ga0214917_1000120732 | 3300022752 | Freshwater | MKRQWNAAMQSLVLIRMGQELGTDSSLAQTVAHAIDFVIGTLTRFLS |
| Ga0214917_100352977 | 3300022752 | Freshwater | MKRRINSLIQSLVLIRFGQELGTSSDLAQAVAGSIDFVLGTLARFLG |
| Ga0214917_100648325 | 3300022752 | Freshwater | MTRNWNAAIHSLVCVRLGQELGTSSDLAQAIAHSIDFVLGVLARFLG |
| Ga0214917_100761212 | 3300022752 | Freshwater | MKHHWKRGWSSLLHSLVCVRLGQELGTSSDLAQAVAHSIDFVLGALARFLG |
| Ga0214917_104365282 | 3300022752 | Freshwater | TSFNVTEDTMARTWNAAIHSLVCVRLGQELGTSSDLAQAIAHSIDFALGIIARFCS |
| Ga0214921_100272413 | 3300023174 | Freshwater | MTRRWNAALQSLVLVRLGQELGCDSSLAQTVAHAIDFAVGTLAKFLP |
| Ga0214923_100109577 | 3300023179 | Freshwater | MKRFWNSALKSLLLVRLGQELGTSSELAQAVAHGIDFVLGTIARFCS |
| Ga0214923_100163683 | 3300023179 | Freshwater | MKRFWNSALKSLLLVRLGQELGTSSELAQAVAHGIDFFVGCISRFFP |
| Ga0214923_100538753 | 3300023179 | Freshwater | MQRYWNAALHSLLCVRLGQELGTSSDLAQAIAHSIDFVLGTLARFIG |
| Ga0214923_101462083 | 3300023179 | Freshwater | MARTWNAAIHSLVCVRLGQELGTSSELAQGLAGAIDWLLSIAARFCS |
| Ga0214923_101463616 | 3300023179 | Freshwater | MNRHWNAAIHSLICVRLGQELGTSSDLAQGLAGAIDWVIALAARFAG |
| Ga0214923_101475083 | 3300023179 | Freshwater | MNRYWNTALHSMLCVRLGQELGTTSELAQAVAHSIDFVLGTLARFLG |
| Ga0214923_101720811 | 3300023179 | Freshwater | MPRRWNAALQSLVLVRLGQELGTSSELAQGLAGAIDWLLSIAARFCS |
| Ga0214923_102159613 | 3300023179 | Freshwater | MARTWNAAIHSLVCVRLGQELGTSSDLAQAIAHSIDFALGIIARFCS |
| Ga0214923_102175744 | 3300023179 | Freshwater | MTRTWNAAIHSLVCVRLGQELGTSSDLAQAIAHSIDFALGIIARFCS |
| Ga0214923_103353274 | 3300023179 | Freshwater | MNRHWNAAIHSLICVRLGQELGTSSELAQGLAGAIDWLLSIAARFCS |
| Ga0208864_100084713 | 3300025578 | Freshwater | MTRNWNAALQSLVLIRLGQELGTSSDLAQAIAHSIDALVHALAGALAR |
| Ga0208546_10018571 | 3300025585 | Aqueous | MARIWNRLLEQLVLVRLGQELGTDSELAQAIAGGIDFALGTLARFIG |
| Ga0208975_10673622 | 3300027659 | Freshwater Lentic | MKRYWNNALQSLVLVRMGQELGTDSDLAQAVAHSIDFVLGTLARFFS |
| Ga0209188_11308051 | 3300027708 | Freshwater Lake | MKSHWKRCWNTLLHSLVCVRLGQELGTSSELAQAVAGSIDFVLKTLARFL |
| Ga0209297_100025329 | 3300027733 | Freshwater Lake | MTRRWNAALQSLVLVRLGQELGTDSSLAQTVAHAIDFAVGTLARFLP |
| Ga0209085_10092199 | 3300027741 | Freshwater Lake | MKTHWKRCWNTLLHSLVCVRLGQELGTSSDLAQAVAHSIDFVLGTLSRFLG |
| Ga0209085_10468432 | 3300027741 | Freshwater Lake | MTRTWNAAIHSLVCVRLGQELGTSSDLAQAIAHSIDFVLGILARFCG |
| Ga0209085_11259202 | 3300027741 | Freshwater Lake | MKRRWNAALQSLVLVRLGQELGCDSSLAQTVAHAIDFAVGTLARFLP |
| Ga0209085_12183481 | 3300027741 | Freshwater Lake | MKRRLDAALQSLVLIRLGQELGTDSDIAQAVAHGIDFVLGTLARFLG |
| Ga0209189_10051068 | 3300027747 | Freshwater Lake | MTRRWNAALQSLVLVRLGQELGTSSDLAQAIAHSIDALLDSLARFLS |
| Ga0209189_11737211 | 3300027747 | Freshwater Lake | MKRRIDAALQSLVLIRFGQELGTDSDLAQAVASAIDFAIGTISRLLT |
| Ga0209598_103171661 | 3300027760 | Freshwater Lake | MRRRLDAALQSLVLIRFGQELGTDSDIAQAVAHGIDFVLGTLARFLG |
| Ga0209972_1000296217 | 3300027793 | Freshwater Lake | MPRTWNAAIHSLLCIRLGQELGTSSELAQTIAHSIDFAVGTLARILG |
| Ga0209401_10421203 | 3300027971 | Freshwater Lake | MKRRLDAALQSLVLIRFGQELGTDSDLAQAVASVIDFAIGTISRLLT |
| Ga0209401_10807543 | 3300027971 | Freshwater Lake | MRRRLNAALQSLVLIRLGQELGTDSDIAQAVAHGIDFVLGTLAKFLG |
| Ga0209401_11269322 | 3300027971 | Freshwater Lake | MKRRIDAALQSLVLIRFGQELGTDSDLAQAVASVIDFAIGTISRLLT |
| Ga0209298_100002431 | 3300027973 | Freshwater Lake | MPRTWNAAIHSLLCIRLGQELGTSSELAQTIAHSIDFVLGTLARFLG |
| Ga0209298_101829991 | 3300027973 | Freshwater Lake | MKSHWKRCWNTLLHSLVCVRLGQELGTSSELAQAVAGSIDFVLKTL |
| Ga0209299_11719043 | 3300027974 | Freshwater Lake | MKSHWKRCWNTLLHSLVCVRLGQELGTSSELAQAVAGSIDFVLKTLA |
| Ga0315907_101985651 | 3300031758 | Freshwater | SFTVTEDTMPRTWNAAIHSLLCIRLGQELGTSSELAQTIAHSIDFAVGTLARILG |
| Ga0334994_0002654_12402_12545 | 3300033993 | Freshwater | MARIWNRLLEQLVLVRLGQELGTDSDLARAIAHCIDFALGTLARFLG |
| Ga0334994_0108105_1154_1297 | 3300033993 | Freshwater | MTRYWNTALHSLLCVRLGQELGTTSELAQAVAHSIDFVLGTLARFLG |
| Ga0334994_0195237_640_783 | 3300033993 | Freshwater | MKRQWNAAMKSLLLIRVGQELGTSSELAQAIAHSIDFVLGTLARFFS |
| Ga0334995_0018993_636_779 | 3300034062 | Freshwater | MKRQWNAAMQSLVLIRMGQELGTDSSLAQNIAHAIDFVIGTLTRFLS |
| Ga0334995_0167870_1177_1320 | 3300034062 | Freshwater | MKRQWNAAIKSLLLVRVGQELGTSSELAQTIAHSIDFVLGTLARFLS |
| Ga0335000_0068240_2_133 | 3300034063 | Freshwater | MHKRWNAALHALLCVRLGQELGTSSELAQTIAHGIDFALGTVAR |
| Ga0335025_0001594_13141_13284 | 3300034096 | Freshwater | MKRRWNAALQSLVLVRMGQELGTDSDLAQAVAHSIEFVLGTLARFFS |
| Ga0335025_0021076_2780_2914 | 3300034096 | Freshwater | MNWNAALQSLVLVRLGQDLGHDSKLARAIHNLIDLLVNVATGIF |
| Ga0335027_0224185_947_1090 | 3300034101 | Freshwater | MQRRWNAAMQSLVLVRLGQELGTDSSLAQTVAHAIDFAVGTLARFLP |
| Ga0335066_0558591_290_433 | 3300034112 | Freshwater | MTRYWNTALHSLLCVRLGQELGTTSELAQAVAHSIDFVLGSLARFLG |
| Ga0335060_0258827_752_895 | 3300034122 | Freshwater | MKRHWNNALQSLVLIRFGQELGTDSDLAQAVAHSIDFVLGTLARIFS |
| Ga0335060_0453377_31_174 | 3300034122 | Freshwater | MKRRWNAALQSLVLVRMGQELGTDSDLAQAVAHSIDFVLGTLARFLP |
| Ga0335013_0220946_93_245 | 3300034284 | Freshwater | MAHMKRRINSLIQSLVLVRFGQELGTDSQAAQAVAHAIDFVVSTLARFLG |
| ⦗Top⦘ |