NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F102425

Metagenome Family F102425

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102425
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 118 residues
Representative Sequence MPEPIAPYHERLPDLERELTERGSLGVLVLDASRLAVIEDEYGTPAYEEVRQRVFKILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSSLVPNL
Number of Associated Samples 90
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.25 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.06 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(11.881 % of family members)
Environment Ontology (ENVO) Unclassified
(29.703 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(33.663 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.36%    β-sheet: 10.42%    Coil/Unstructured: 47.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF05157T2SSE_N 48.51
PF00072Response_reg 2.97
PF05977MFS_3 1.98
PF05681Fumerase 0.99
PF01975SurE 0.99
PF02580Tyr_Deacylase 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 1.98
COG0496Broad specificity polyphosphatase and 5'/3'-nucleotidase SurEReplication, recombination and repair [L] 0.99
COG1490D-aminoacyl-tRNA deacylaseTranslation, ribosomal structure and biogenesis [J] 0.99
COG1951Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domainEnergy production and conversion [C] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104555404All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300002243|C687J29039_10159006All Organisms → cellular organisms → Bacteria → Proteobacteria807Open in IMG/M
3300002917|JGI25616J43925_10266389All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300003989|Ga0055473_10313487All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300003995|Ga0055438_10023676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1417Open in IMG/M
3300004114|Ga0062593_102224708All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300004156|Ga0062589_100115820All Organisms → cellular organisms → Bacteria → Proteobacteria1751Open in IMG/M
3300004282|Ga0066599_101003684All Organisms → cellular organisms → Bacteria → Proteobacteria607Open in IMG/M
3300005168|Ga0066809_10240091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300005174|Ga0066680_10561345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300005180|Ga0066685_10702914All Organisms → cellular organisms → Bacteria → Proteobacteria693Open in IMG/M
3300005181|Ga0066678_10453622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium852Open in IMG/M
3300005186|Ga0066676_10157187All Organisms → cellular organisms → Bacteria → Proteobacteria1434Open in IMG/M
3300005441|Ga0070700_100041859All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2810Open in IMG/M
3300005457|Ga0070662_100743769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300005718|Ga0068866_11141946All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300005829|Ga0074479_10449456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium976Open in IMG/M
3300005836|Ga0074470_11802832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300006047|Ga0075024_100319167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium767Open in IMG/M
3300009091|Ga0102851_12484658All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300009131|Ga0115027_10609734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium805Open in IMG/M
3300009131|Ga0115027_11321277All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300009157|Ga0105092_10266430All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium964Open in IMG/M
3300009157|Ga0105092_10357552All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium828Open in IMG/M
3300009179|Ga0115028_10687448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium779Open in IMG/M
3300009179|Ga0115028_11262389All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300009808|Ga0105071_1061156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300010359|Ga0126376_11847282All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300011422|Ga0137425_1192312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300012164|Ga0137352_1058577All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium759Open in IMG/M
3300012202|Ga0137363_10079383All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2440Open in IMG/M
3300012206|Ga0137380_10736794All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium854Open in IMG/M
3300012206|Ga0137380_11614208All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300012912|Ga0157306_10232799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300012964|Ga0153916_10838973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium999Open in IMG/M
3300013308|Ga0157375_11990280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300014324|Ga0075352_1267602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300014876|Ga0180064_1050390All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300014884|Ga0180104_1037409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1268Open in IMG/M
3300017966|Ga0187776_11619728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300018055|Ga0184616_10079971All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1141Open in IMG/M
3300018055|Ga0184616_10349546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300018059|Ga0184615_10452320All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300018072|Ga0184635_10266481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300018078|Ga0184612_10549737All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300019458|Ga0187892_10106817All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300021082|Ga0210380_10431820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300021432|Ga0210384_10068816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3189Open in IMG/M
3300025160|Ga0209109_10290977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300025165|Ga0209108_10404460All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300025174|Ga0209324_10670979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300025289|Ga0209002_10616107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300025797|Ga0210062_1149103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300025933|Ga0207706_11003578All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300026349|Ga0256811_1043069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300026357|Ga0256810_1025981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300026357|Ga0256810_1069105All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300027561|Ga0209887_1104705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300027890|Ga0209496_10617881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300027897|Ga0209254_10839590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300027900|Ga0209253_10223026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1495Open in IMG/M
3300027907|Ga0207428_10100645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2234Open in IMG/M
3300027909|Ga0209382_10606260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1191Open in IMG/M
3300027948|Ga0209858_1024913All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300028803|Ga0307281_10048324All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1330Open in IMG/M
3300028812|Ga0247825_10227955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1292Open in IMG/M
3300030114|Ga0311333_11071187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300031521|Ga0311364_12173631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300031728|Ga0316578_10315828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium933Open in IMG/M
3300031733|Ga0316577_10753931All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300031834|Ga0315290_10311653All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1378Open in IMG/M
3300031944|Ga0310884_10263525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium947Open in IMG/M
3300031949|Ga0214473_10165578All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2568Open in IMG/M
3300031949|Ga0214473_10553145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1276Open in IMG/M
3300031965|Ga0326597_11832940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300031997|Ga0315278_10520772All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1222Open in IMG/M
3300032012|Ga0310902_10603692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300032143|Ga0315292_10849168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300032177|Ga0315276_11777967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300032256|Ga0315271_10414047All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1131Open in IMG/M
3300032342|Ga0315286_11183064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium749Open in IMG/M
3300032342|Ga0315286_11223965All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium733Open in IMG/M
3300033408|Ga0316605_11221239All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300033408|Ga0316605_11338492All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300033408|Ga0316605_11702098All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300033414|Ga0316619_11598317All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300033416|Ga0316622_100492860All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1394Open in IMG/M
3300033417|Ga0214471_10281578All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1355Open in IMG/M
3300033418|Ga0316625_100556616All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium923Open in IMG/M
3300033433|Ga0326726_10419528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1271Open in IMG/M
3300033434|Ga0316613_10336959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1004Open in IMG/M
3300033483|Ga0316629_10284537All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1107Open in IMG/M
3300033483|Ga0316629_10719826All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium757Open in IMG/M
3300033485|Ga0316626_10317269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1275Open in IMG/M
3300033513|Ga0316628_100007585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium9007Open in IMG/M
3300033550|Ga0247829_11178296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300033551|Ga0247830_11395557All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300033557|Ga0316617_102431801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300034115|Ga0364945_0061226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1064Open in IMG/M
3300034147|Ga0364925_0138028All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium881Open in IMG/M
3300034690|Ga0364923_0139451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil11.88%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment6.93%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland4.95%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.95%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.96%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment2.97%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.97%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.97%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.97%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.98%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.98%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.98%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.99%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.99%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.99%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.99%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.99%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.99%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002243Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300003989Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2EnvironmentalOpen in IMG/M
3300003995Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300012164Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014876Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025174Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025797Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026349Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU6EnvironmentalOpen in IMG/M
3300026357Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU5EnvironmentalOpen in IMG/M
3300027561Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027948Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031728Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrCHost-AssociatedOpen in IMG/M
3300031733Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1Host-AssociatedOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034690Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10455540423300000364SoilMSEPIAPYYERLADLERELSDRGSLGVLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIDESRGKDYRXGDVICLDRPRGLRFLFLLDRKRRRSVALSVADL
C687J29039_1015900613300002243SoilMAEPIAPYHERLPDLERELTDRGSLGLLVLDAAPLGTIEDEYGTPAYEEVRQRVFKILEESRGKDYRQGDVLCLDRPRGLRFLFLLDRKRRRSVPLSVADLRTARGRVVASLAPNIARAA
JGI25616J43925_1026638923300002917Grasslands SoilVGTLRLIVEPFPPYQERLPELQRELTERGSLGLLVLDASALAAIEDQYGTESYEEVRQRVFKILEEQRGKDYRDGDILTIDRPRGLRFLFFLERKRRRDVPFSIADLKAARGRLLSSLLPNLSRASFPYLKT
Ga0055473_1031348713300003989Natural And Restored WetlandsMPEPIAPYHEALPDLDRELTERGNLGVIVLDASPLADIEDKYGLTAYEEVRQQVLADIEAARGKDYRAGDILCLDRPRGLRFLFFLDRKRRRNVPMSVADLRAARARVLSSLVPGLARRGFS
Ga0055438_1002367613300003995Natural And Restored WetlandsMAEPIAPYHERLPDLERELTDRGSLGVLVLDASPLATIEDQYGTPAYEEVRQRMFRILDESRGKDYRQGDVVCLDRPRGPRFLFALDRKRRRSVPLSVADLRTARSRVVASLAPNI
Ga0062593_10222470823300004114SoilMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSIADLRT
Ga0062589_10011582013300004156SoilMSEPIAPYYERLADLERELSDRGSLGVLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSVADLRTARGRVV
Ga0066599_10100368413300004282FreshwaterMPEPIAPYHERLPDLERELTERGSLGVLVLDASRLAVIEDEYGTPAYEEVRQRVFKILDESRGKDYRLGDILCLDRPRGLRFLFLLDRKRRRNVALSV
Ga0066809_1024009113300005168SoilMSEPIAPYHERLADLERELTDRGSLGLLVLDATPLGRIEDEYGTRAYEEVRQRFFKIIDESRGKDYRQGDVICLDRPRGLRFLFLLDRKRRRSVALSVADLRTARGRVVSSLAPNIARAAFPYIKTPPRLEVGHGLAV
Ga0066680_1056134523300005174SoilMSEPIPPYHDRLADLVKELSEAGCLGVLVLDLGPLAVIEDQYGIDAYEEVRQRVFTILEEHKGKDYRTGDILSLDRPRGLRFIFFLERKRRRNVPFSVADLRA
Ga0066685_1070291413300005180SoilMSEPIPAYHDRLADLVKELTEAGCLGVLVLDLGALAAIEDQYGIDAYEEVRQRVFKILEEHKGKDYRTGDILSLDRPRGLRFIFFLERKRRRNVPFSVADLRAARGR
Ga0066678_1045362223300005181SoilMSEPIPSYHDRLADLVKELTEAGCLGVLVLDLGPLAAIEDQYGIEAYEEVRQRVFKILEEHKGKDYRTGDILGLDRPRGLRFIFFLERK
Ga0066676_1015718713300005186SoilMSEPIPAYHDRLADLVKELTEAGCLGVLVLDLGALAAIEDQYGIDAYEEVRQRVFKILEEHKGKDYRTGDILSLDRPRGLRFILFLERKRRRNVLFSVADLRAARGRLLGSLLSNL
Ga0070700_10004185943300005441Corn, Switchgrass And Miscanthus RhizosphereMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSIADLRTARGRVVS
Ga0070662_10074376913300005457Corn RhizosphereMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSIADLRTARGRVVSSLAPNIARAAFPYIKTPPR
Ga0068866_1114194623300005718Miscanthus RhizosphereMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSIADL
Ga0074479_1044945613300005829Sediment (Intertidal)MSEPIAPYHERLPDLERELTDRGSLGLLVLDAAPLGTIEDEYGTPAYEEVRQRVFKILEEQRGKDYRQGDVLCLDRPRGLRFLFVLDRKRRRSVPLSIADLRTARGRVVASLAPNIARASFPY
Ga0074470_1180283213300005836Sediment (Intertidal)MPDSIPPYHERLAELERELLDRGSLGVLVLDASPLAAIEDQYGTTAYEEVRHRAYKVLEESRTKDYRQGDVICIDRPRGLRFLFFLDRKRRRNVALSVADLRVARNRVASSLGPNLARAAFPYLKGSPRLEVGHGLAVYNPLRHTERAIERAL
Ga0075024_10031916713300006047WatershedsVPEPILSYHERLPELEKELTETGSLGVLVVDAGPLAVIEDQYGLEAYEEVRKRLFKILAEQKGKDYRTGDILSLDRPRGLRFIFFLERKRRRDI
Ga0102851_1248465813300009091Freshwater WetlandsMPEPIAPYHERLPDLERELAERGSVGVLVLDASPLAAIEDEYGTPAYDEVRQRAFKILDESRGKDYRQGDIICLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSSL
Ga0115027_1060973413300009131WetlandMPEPIAPYHERLPDLERELAERGSLGVLVLDASPLATIEDEYGTPAYDEVRQRVFKIIDESRGKDYRQGDVLCLDRPRGLRFVFLLDRKRRRNVALSVGDLRTARGRLVTSLVP
Ga0115027_1132127723300009131WetlandMSEPITPYHERLPDLERELAERGSLGVLVLDASVFSTIEDEYGTPAYEEVRQRVFKILDESRGKDYRQGDILCLDRPRGLRFLFFLDRKRRRTVPLSVADLRTACSRVVSSLVE
Ga0105092_1026643023300009157Freshwater SedimentMPDSIPPYHDRLAELERELLDRGSIGVLVLDASPLSAIEDQYGTTAYEEVRHRAYKALDESRGKDYRHGDVICLDRPRGLRFIFFLDRKRRRNVALSVADLRCARGRVVSSLVPNLGRAAFPYI
Ga0105092_1035755213300009157Freshwater SedimentMRATEAMPEPIATYHERLPDLERELTDRGSLGVLVLDASPLATIEQEYGAVAYEEVRQRVVKILDESRGKDYRQGDILCLDRPRGLRILFLLDRKRRRTVPL
Ga0115028_1068744823300009179WetlandMPEPIAPYHDRLPDLERELSERGSLGVLVLDASPLATIEDEYGTPAYEEVRQRVFKIIDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSS
Ga0115028_1126238913300009179WetlandMPEPIAPYHERLPDLERELAERGSVGVLVLDASPLAAIEDEYGTPAYDEVRQRAFKILDESRGKDYRQGDIICLDRPRGLRFLFLLDRKRRRNVALSVADLR
Ga0105071_106115613300009808Groundwater SandMMPEPISSYHERLPEIEKELTERGHVGLLVLDASPLAVIEDQYGMDAYEEVRQRVFKILDEQKGKDYRTGDILGLDRPRGLRFLFFLERKRRRNVASSVADLRAARGRLLASLVPNVSRASHPYLKPPPRLDVGYGV
Ga0126376_1184728223300010359Tropical Forest SoilMLEPIAPYHERLPDLERELADRGSLGLLVLDATPLGRIEDEYGTPEYEAVRQRIYRILDESRGKDYRQGDVLCLDRPRGLRVMFMLDRNRRRTVPLTVADLRT
Ga0137425_119231213300011422SoilMMPEPIAPYHERLPDLDRELTERGSIGVLVLDASPLAGIEDGYGTPAYEEVRQRVFQILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTVRGRLMSSLVPNLSRAAFPYLKTAPRIEVGHG
Ga0137352_105857713300012164SoilMMPEPIAPYHERLPDLERELTDRGSLGLLVLDAAPLGTIEDEYGTPAYEEVRQRVFKILEESRGKDYRQGDVLCLDRPRGLRFMFLLDRKRRRSV
Ga0137363_1007938313300012202Vadose Zone SoilMSEPIPPYHDRLADLVKELTEAGCLGVLVLDLGALAAIEDQYGIDAYEEVRQRVFKILEEHKGKDYRTGDILSLDRPRGLRFIFFLERKRRRNVPFSVADLRAARGRLLGSLLSNLSRAAFPYLKAVPRLDVGCAVAVHNP
Ga0137380_1073679413300012206Vadose Zone SoilMSEPIPPYHDCLADLVKELAEAGCLGVLVLDLGPLAVVEDQYGIDAYEEVRQRVFKILEEHKGKDYRTGDILSLDRPRGLRFIFFLERKRRRNVPFS
Ga0137380_1161420823300012206Vadose Zone SoilMSEPIPPYHDRLADLVKELSEAGCLGVLVLDLGPLAVIEDQYGIDAYEEVRQRVFTILEEHKGKDYRTGDILSLDRPRGLRFIFFLERKRRRNVPFSV
Ga0157306_1023279923300012912SoilMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKR
Ga0153916_1083897313300012964Freshwater WetlandsMSEPIAPYHERLPDLERELAERGSLGVLVLDASPLARIEDEYGTLAYEEVRQRVFRILEESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRTVPLSVADL
Ga0157375_1199028013300013308Miscanthus RhizosphereMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSIADLRTARGRVVSSLAPNIARAAFPYIKTPPRLDVGHGLA
Ga0075352_126760223300014324Natural And Restored WetlandsMPEPIAPYHERLPDLERELTDRGSLGLLVLDAAPLGTIEDEYGTPAYEEVRQRVFKILEEQRGKDYRMGDVLCLDRPRGLRFLFVLDRKRRRSVPLSIADLRTARGRVVASLAPNIARAA
Ga0180064_105039023300014876SoilMPEPIPPYHERLPEIEKELTERGHVGLLVLDASPLASIEDQYGMDAYEEVRQRVFKILDEQKGKDYRTGDILSLDCPRGLRFLYFLERKRRRNVASSVADLRAARGRLMASLVPNLARAAHPYLKPPPRLDVGYGVAVYNPLL
Ga0180104_103740913300014884SoilMMPEPIAPYHERLPDLERELTERGSLGALVLDASPLAAIEDEYGTPAYEEVRQRVFKILEESRGKDYRQGDVLCLDRPRGLRFMFLLDRKRRRSVPLSIADLRTARGR
Ga0187776_1161972813300017966Tropical PeatlandMPEPIAPYNERLPDLERELTDRGSLGLLVLDAAPLETIEDEYGAPAYEEVRQRVFKILEEARGKDYRQGDVVCLDRPRGARIMIALDRKRRRSVPLSMADLRTARSRVVASLAPNVARAAFPYIKTP
Ga0184616_1007997123300018055Groundwater SedimentMPEPIAPYHERLPDLERELMERGSLGVLVLDASPLAAIEDEYGTPAYEEVRLRAFKLLDESRGKDYRHGDILCLDRPRGLRFLFLLDRKRRRSVALSVADLRTARLRVVSSLVPNLSRAAYPYIKT
Ga0184616_1034954613300018055Groundwater SedimentMPEPIAPYHERLLDLDREVTERGSLGVLVFDAFPLAAIEDEYGTLAYEEVRQRVFKILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSLLVPNLSRAAFPYIKAAPRIEVGYGLAVYN
Ga0184615_1045232013300018059Groundwater SedimentMPEPIAPYYERLPDLERELTERGSLGVLVVDASPLATIEDEYGTPAYEEVRQGLFKILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRCRNVALSIADLRTARSRLVGSLVPNLARTAFPYMKTAARIEVGYGLVVQNPLLRMQEGTVMSFEALSRGPRGSGL
Ga0184635_1026648123300018072Groundwater SedimentMSEPIAPYHERLADLERELTDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIDESRGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSVADLRTARGRVVSSLAPNIARAAFPYIKTPPRLEVGHGLAV
Ga0184612_1054973713300018078Groundwater SedimentMSEPIAPYHERLADLERELTDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIDESRGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSVADLRTARGRVVSSLAPNIARAAFPYIK
Ga0187892_1010681713300019458Bio-OozeMSEPIVPYHERLSELERELSERGALGLLVLDASSLGAIEDQYGARAYDEVRQRLFKLLDEQRGKDYRIQDILALDQPRGLRFILFLERKRRRNVPFALADLRAARSRLLSSLLPQMARAAFPYLKDPPRLAVGYGLAIHNPLRHV
Ga0210380_1043182023300021082Groundwater SedimentMSEPIAPYHERLADLERELTDRGSLGLLVLDATPLGRIEDEYGTRAYEEVRQRFFKIIDESRGKDYRQGDVICLDRPRGLRFLFLLDRKRRRSVALSV
Ga0210384_1006881653300021432SoilVEPFPPYQDRLLEVQRELTERGSLGLLVLDASALADIEDQYGTEAYEEVRQRVFKILEEQRGKDYRDGDILTIDRPRGLRFLFFLERKRRRDVPFSISDLRAARGRLLSSLLPHLSRASFPYFKTAPRLAV
Ga0209109_1029097713300025160SoilMRATEAMSEPIAPYHERLPDLERELTDRGSLGLLVLDAAPLGTIEDEYGTPAYEEVRQRVFKILEESRGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVPLSIADLRTARGRV
Ga0209108_1040446013300025165SoilMPETIAAYDERLPDLEAQLTEWGSLGVLVVDASPLSSIEDEYGVEAYLEVRERLLKTLDEARGKDYRSGDVLCLDRPRGLRFLFFLERKRRRNVPLSVADLRAAR
Ga0209324_1067097923300025174SoilMAEPIAPYHERLPDLERELMDRGSLGLLVLDAAPLGTIEDEYGTPAYEEVRQRVFKILEESRGKDYRQGDVLCLDRPRGLRFLFLLDRKRRRSVPLSVADLRTARGRVVASLAPNIARAAFP
Ga0209002_1061610723300025289SoilMAEPIAPYHERLPDLERELTDRGSLGLLVLDAAPLGTIEDEYGTPAYEEVRQRVFKILEESRGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVPLSIADLRTARGRVVASLAPNIARAAFPYIKTPP
Ga0210062_114910313300025797Natural And Restored WetlandsMPEPIAPYHEALPDLDRELTERGNLGVIVLDASPLADIEDKYGLTAYEEVRQQVLADIEAARGKDYRAGDILCLDRPRGLRFLFFLDRKRRRNVPMSVADLRAARARVLSSLVPGLARRGFSY
Ga0207706_1100357823300025933Corn RhizosphereMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSIADLRTARGRVVSSLAPNIARAAFPYIKTPPRLDVG
Ga0256811_104306913300026349SedimentMPDSIAPYHERLQELERELVDRSSLGLLVLDASALSSIEDRFGTTAYDEVRQRVYKVLEETRGKDYRQGDLVCLDRPRGLRFLFFLDRKRRRNVALSVADLRSARGRLTASVVPNVGRAAFPYLKGAPRVDCGHGLAVYNPLLHTERAIERAVDEAV
Ga0256810_102598123300026357SedimentMPDSIAPYHERLSELERELVDRSSLGLLVLDASALSSIEDRFGTTAYDEVRQRVYKVLEETRGKDYRQGDLVCLDRPRGLRFLFFLDRKRRRNVALSVADLRSARGRLTASVVPNVGRAAFPYLKGAPRVDCGHGLAVYNPLLHTERAIERAVDEAV
Ga0256810_106910513300026357SedimentMPDSIPPYHERLAELERELLDRGSLGVLVLDASPLAAIEDQYGTTAYEEVRHRAYKVLEESRSKDYRQGDVICLDRPRGLRFLFFLDRKRRRNVALSIADLRSARSRIVSSLVPNLGRAAFPYIKGSPRLEVGHGLAVYNPPLHT
Ga0209887_110470513300027561Groundwater SandMPEPIPPYHERLPEIEKELTERGHVGLLVLDASPLAVIEDHYGMDAYEEVRQRVFKALDEQKGKDYRTGDILGLDRPRGLRFLFFLERKRRRNVASSVADLRAARGRLLSSLVPNLSRAPFPYLKTMPRLDVGYGVAVHNPLLHPARMV
Ga0209496_1061788113300027890WetlandMPEPIAPYHDRLPDLERELSERGSLGVLVLDASPLATIEDEYGTPAYEEVRQRVFKIIDESRGKDYRQGDILCLDRPRGLRFVFLLDRKRRRNVALSVGDLRTARSRVVASL
Ga0209254_1083959013300027897Freshwater Lake SedimentMPEPIAPYHERLPDLERELTERGSLGVLVLDASRLAVIEDEYGTPAYEEVRQRVFKILEESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSSLVPNLARAA
Ga0209253_1022302613300027900Freshwater Lake SedimentMPEPIAPYHERLLDLDRELTERGSLGVLVLDASPLATIEDEYGTPAYEEVRQRAFKILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSS
Ga0207428_1010064513300027907Populus RhizosphereMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSI
Ga0209382_1060626013300027909Populus RhizosphereMSEPIAPYHERLADLERELTDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIDESRGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSVADLRT
Ga0209858_102491313300027948Groundwater SandMFEPIAPYHERLADLERELTDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIDESRSKDYRQGDVVCLDRPRGLRILFLLDRKRRRSVALSVADLRTARGRVVASL
Ga0307281_1004832413300028803SoilMPEPITPYHERLPDLERELTERGSLGVLVLDASPLAAIEDEYGTPAYEEVRQRVFKILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSSLAPNLARASFPFIKAAPRIEVGYGLAVHNPLLH
Ga0247825_1022795523300028812SoilMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSIADLRMARGRVVSSLAPNIARA
Ga0311333_1107118713300030114FenMPDPIAPYHERLAELERDLAERGSLGLLVVDASPFAAIEDEYGTAAYEEVRQRAFKAVEESRGKDYRQSDVVCLDRPRGLRFLFFLDRKR
Ga0311364_1217363113300031521FenMPDPIAPYHERLAELERDLAERGSLGLLVVDASPFAAIEDEYGTAAYEEVRQRAFKAVEESRGKDYRQSDVVCLARPRGLRFLFFLDRKRRRN
Ga0316578_1031582813300031728RhizosphereMSEPIASYHERLPDLDRELTERGSLGLLVLDASLLRGIEDRFGLQAYEEVRDRVLTIIEEARGKDYRAGDLLCLDRPRGTRFLFLLERKRRRNVPLSVADLRAARARVMSSLVPSIARTAFPYIKAGDVP
Ga0316577_1075393113300031733RhizosphereMPEPIAPYYERLPDLDRELTERGSLGLLVLDASLLRSIEDRYGLQAYEEVRQRMLTIIEDARGKDYRAGDILCLERPRGLRFLFLLERKRRRNVPLSVADLRAARARVMSSLVPSIARAAFPYI
Ga0315290_1031165323300031834SedimentMPEPIAPYHERLPDLERELTERGSLGVLVLDASRLAVIEDEYGTPAYEEVRQRVFKILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSSLVPNLARAAFPYIKATPRIEVGHGLA
Ga0310884_1026352523300031944SoilMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSVADLRTARGRVVSSLAPNIARAAFPYIKTPPRLEVGHGLAVHNP
Ga0214473_1016557813300031949SoilMAEPIAPYHERLPDLERELTDRGSLGLLVLDAAPLGTIEDKYGTPAYEEVRQRVFKVMEESRGKDYRQGDVLCLDRPRGLRFLFLLDRKRRRSVP
Ga0214473_1055314523300031949SoilMPEPIAPYHERLPDLERELTDRGSLGLLVLDAAALGTIEDKYGTPAYEEVRQRVFKVMEESRGKDYRQGDVLCLDRPRGLRFLFLLDRKRRRSVPLSIADLRTARGRVVASLAPNIARTAFPYIKTPPRLDV
Ga0326597_1183294013300031965SoilMSDPVPTYHERLPDVERELIERGSIGLLVLDTTSLGAIEDQYGAEAYDEVCQRVFKLLEEQKGKDYRANDILTLDRPRGLRFILFLERKRRR
Ga0315278_1052077223300031997SedimentMPEPIAPYHERLPDLERELTERGSLGVLVLDASRLAVIEDEYGTPAYEEVRQRVFKILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVS
Ga0310902_1060369213300032012SoilMSEPIAPYHERLADLERELTDRGSLGLLVLDATPLGRIEDEYGTRAYEEVRQRFFKIIDESRGKDYRQGDVICLDRPRGLRFLFLLDRKRRRSVALSVADLRTARGRVVSSLAPNIARAAFPYIKTPPRLDVGHGLA
Ga0315292_1084916813300032143SedimentMPEPIAPYHERLSDIERELTERGCLGVLVLDASPLAAIEDEYGTPAYEEVRQRVFQTLDESRGRDYRQGDIVCLDRPRGLRFLFLLGSKRRRNVPL
Ga0315276_1177796723300032177SedimentMPEPIAPYHERLPDLERELTERGSLGVLVLDASRLAVIEDEYGTPAYEEVRQRVFKILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSSLVPNLARAA
Ga0315271_1041404723300032256SedimentMPEPIAPYHERLPDLERELTERGSLGVLVLDASRLAVIEDEYGTPAYEEVRQRVFKILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSSLVPNL
Ga0315286_1118306413300032342SedimentMPESIAPYHERLPDIERELTERGCLGVLVLDASPLSAIEDEYGTPAYEEVRQRVFQILDEARGRDYRQGDILCLDRPRGLRFLFLLDRKRRRSVALSVADLRTARGRVASSL
Ga0315286_1122396523300032342SedimentMPEPIAPYHERLPDIERELTERGCLGVLVLDASPLAAIEDEYGTPAYEEVRQRVFQILDESRGRDYRQGDILCLDRPRGLRFLFLLDRKRR
Ga0316605_1122123913300033408SoilMPDSIPPYHERLAELERELLDRGSLGVLVLDASPISAIEDEYGTTAYEEVRHRVAKALEESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRCARGRIVSSLVPNLGRAAFPYIKGSPRLEVGHGLAVYNPL
Ga0316605_1133849223300033408SoilMPEPIAPYHERLPDLERELAERGSLGVLVLDASSVATIEDDYGTLAYEEVRQRIFRILDESRGKDYRQGDILCLDRPRGRRFLFFLDRKRRRTVPLSVADLRAARQRVVSSLVPKLSRAAFPYLKEAPPSDVG
Ga0316605_1170209823300033408SoilMPEPIAPYHERLPDLERELAERGSVGVLVLDASPLAAIEDEYGTPAYDEVRQRAFKILDESRGKDYRQGDIICLDRPRGLRFLFLLDRKRRRNVALSVADLRTARGRLVSSLVPNLSRAAFPYIKTLPRIE
Ga0316619_1159831713300033414SoilMPEPIAPYHERLPDLERELAERGSLGVLVLDASSVATIEDDYGTLAYEEVRQRIFRILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRTVPLSVADMRTARQRVVSSLVPKLSRA
Ga0316622_10049286013300033416SoilMPEPIAPYHDRLPDLERELSERGSLGVLVLDASPLATIEDEYGTPAYEEVRQRVFKIIDESRGKDYRQGDILCLDRPRGLRFVFLLDRKRRRNVALSVGDLRTARSRVVASLV
Ga0214471_1028157823300033417SoilMRATEAMSEPIAPYHERLPDLERELTDRGCLGVLVLDAAPLGTIEDKYGTPAYEEVRQRVFKILEESRGKDYRLGDVLCLDRPRGLRFLFVLDRKRRRSVPLSIADLRTARGRLVASLAPNIARASFPYIKTPPKLDVGHGLAV
Ga0316625_10055661613300033418SoilMPEPIAPYHERLPDLERELAERGSLGVLVLDASVFSTIEDEYGTPAYEEVRQRVFKILEESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRSVALSVADLRTARGRVVSSLVPNLSRAA
Ga0326726_1041952813300033433Peat SoilMPEPIAPYHERLPDLERDLAERGSLGVLVLDASPLAVIEDKYGTLAYEEVRRRVFRILEESRGKDYRQGDILCLDRPRGARFLFLLDHKRRRTTSLCVADLKTARQRVFS
Ga0316613_1033695913300033434SoilMPEPIAPYHERLPDLERELAERGSLGVLVLDASPLAVIEDEYGTPAYEEVRQRIFKILEEAKGKDYRNGDILCLDRPRGLRFLFLLDRKRRRNVPLSVADLRTARSRVVASLVEKFSRAAYPY
Ga0316629_1028453713300033483SoilMPEPIVPYHERLPDLERELLECGSLGVLVLDASPLSTIEDEYGTLAYEEVRQRVFRILDESRGRDYRQGDILCLDRPRGLRFLFLLERK
Ga0316629_1071982623300033483SoilMPEPIAPYHERLPDIERDLAERGSLGVLVLDASPLARIEDDYGTAAYDEVRQRVFRILDEARGKDYRQGDILCLDRPRGLHFLFLLDRKRRRTAPLSVADLRT
Ga0316626_1031726913300033485SoilMPEPIAPYHERLPDLERELAERGSLGVLVLDASSVATIEDDYGTLAYEEVRQRIFRILDESRGKDYRQGDILCLDRPRGRRFLFFLDRKRRRTVPL
Ga0316628_10000758513300033513SoilMPEPIAPYHERLPDLERELTERGCLGVLVLDASPLATIEQEYGTAAYEEVRQKIFKILDEARGAKEGGYRQGDILCLDRPRGLRFLFLLDRKRRRIVPLSVADLRTARERLAFLLEKIARAAYPYVKSAP
Ga0247829_1117829613300033550SoilMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSIADLRTARGRVVSSLAP
Ga0247830_1139555713300033551SoilMSEPIAPYHERLADLERELSDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIEEARGKDYRQGDVVCLDRPRGLRFLFLLDRKRRRSVALSIADLRTARGRVVSSLAPNIARAAFPYIKTPPRLDVGHGLAVHNPLLH
Ga0316617_10243180113300033557SoilMPEPIAPYHERLPDLERELTERGSLGVLVLDASPLATIEDEYGTPAYDEVRQRVFKIVDESRGKDYRQGDILCLDRPRGLRFVFLLDRKRRRNVPLSVGDLRTA
Ga0364945_0061226_3_2963300034115SedimentMSEPIAPYHERLADLERELTDRGSLGLLVLDASPLGRIEDEYGTRAYEEVRQRFFKIIDESRGKDYRQGDVICLDRPRGLRFLFLLDRKRRRSVALSV
Ga0364925_0138028_1_2883300034147SedimentVPDPILPYHDRLPELQKELMETGHLGILVLDAGPLAIIEDQYGIEAYEEVRKRVFKILEEQKGKDYRSGDILSLDRPRGLRFIFFLERKRRRNVPF
Ga0364923_0139451_259_6273300034690SedimentMMPEPIAPYHERLPDLDRELTERGSIGVLVLDASPLAGIEDGYGTPAYEEVRQRVFQILDESRGKDYRQGDILCLDRPRGLRFLFLLDRKRRRNVALSVADLRTVRGRLMSSLVPNLSRAAFP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.