NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102354

Metagenome / Metatranscriptome Family F102354

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102354
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 131 residues
Representative Sequence MTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV
Number of Associated Samples 82
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 64.36 %
% of genes near scaffold ends (potentially truncated) 41.58 %
% of genes from short scaffolds (< 2000 bps) 74.26 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.218 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(26.733 % of family members)
Environment Ontology (ENVO) Unclassified
(75.248 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(56.436 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 42.86%    β-sheet: 23.31%    Coil/Unstructured: 33.83%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF04012PspA_IM30 29.70
PF13180PDZ_2 7.92
PF15975Flot 3.96
PF13620CarboxypepD_reg 2.97
PF00821PEPCK_GTP 1.98
PF01381HTH_3 0.99
PF00873ACR_tran 0.99
PF13557Phenol_MetA_deg 0.99
PF14559TPR_19 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG1842Phage shock protein ATranscription [K] 59.41
COG1274Phosphoenolpyruvate carboxykinase, GTP-dependentEnergy production and conversion [C] 1.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.22 %
UnclassifiedrootN/A21.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10148284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1011Open in IMG/M
3300009518|Ga0116128_1115028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium786Open in IMG/M
3300009519|Ga0116108_1079351Not Available1008Open in IMG/M
3300009547|Ga0116136_1016615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2504Open in IMG/M
3300009547|Ga0116136_1123753Not Available663Open in IMG/M
3300009623|Ga0116133_1103110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia727Open in IMG/M
3300009630|Ga0116114_1019736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2043Open in IMG/M
3300009630|Ga0116114_1147626Not Available602Open in IMG/M
3300009631|Ga0116115_1136373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia624Open in IMG/M
3300009640|Ga0116126_1094788Not Available1071Open in IMG/M
3300009640|Ga0116126_1140143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia821Open in IMG/M
3300009641|Ga0116120_1088238All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1032Open in IMG/M
3300009643|Ga0116110_1016712All Organisms → cellular organisms → Bacteria → Acidobacteria2895Open in IMG/M
3300009644|Ga0116121_1049540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1321Open in IMG/M
3300009645|Ga0116106_1044106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60761500Open in IMG/M
3300009824|Ga0116219_10282303Not Available939Open in IMG/M
3300009839|Ga0116223_10481213Not Available724Open in IMG/M
3300009839|Ga0116223_10883636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter510Open in IMG/M
3300010339|Ga0074046_10186756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1308Open in IMG/M
3300010379|Ga0136449_100704799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1692Open in IMG/M
3300010379|Ga0136449_100719777All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1669Open in IMG/M
3300010379|Ga0136449_103520095Not Available596Open in IMG/M
3300010379|Ga0136449_104202604Not Available534Open in IMG/M
3300014151|Ga0181539_1086412All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1352Open in IMG/M
3300014152|Ga0181533_1085061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1463Open in IMG/M
3300014153|Ga0181527_1066922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1828Open in IMG/M
3300014160|Ga0181517_10001990All Organisms → cellular organisms → Bacteria → Acidobacteria21682Open in IMG/M
3300014160|Ga0181517_10310590Not Available827Open in IMG/M
3300014160|Ga0181517_10380796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter727Open in IMG/M
3300014164|Ga0181532_10152572All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1388Open in IMG/M
3300014165|Ga0181523_10443219All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia720Open in IMG/M
3300014167|Ga0181528_10885576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia504Open in IMG/M
3300014199|Ga0181535_10061504All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2536Open in IMG/M
3300014199|Ga0181535_10111487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1752Open in IMG/M
3300014493|Ga0182016_10241798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1136Open in IMG/M
3300014655|Ga0181516_10109543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1395Open in IMG/M
3300014839|Ga0182027_12042644Not Available548Open in IMG/M
3300016698|Ga0181503_1178887All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia859Open in IMG/M
3300016700|Ga0181513_1072326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia658Open in IMG/M
3300016702|Ga0181511_1054257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia522Open in IMG/M
3300016750|Ga0181505_10578334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia635Open in IMG/M
3300017925|Ga0187856_1007539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6678Open in IMG/M
3300017935|Ga0187848_10006023All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7860Open in IMG/M
3300017938|Ga0187854_10293000Not Available697Open in IMG/M
3300017940|Ga0187853_10218839Not Available884Open in IMG/M
3300017940|Ga0187853_10229079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia860Open in IMG/M
3300017946|Ga0187879_10086329All Organisms → cellular organisms → Bacteria → Acidobacteria1808Open in IMG/M
3300017948|Ga0187847_10020034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4147Open in IMG/M
3300017948|Ga0187847_10379465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia776Open in IMG/M
3300017975|Ga0187782_10012839All Organisms → cellular organisms → Bacteria → Acidobacteria6137Open in IMG/M
3300017988|Ga0181520_10015994All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus9080Open in IMG/M
3300017988|Ga0181520_10227696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1443Open in IMG/M
3300017998|Ga0187870_1271992Not Available575Open in IMG/M
3300018004|Ga0187865_1276706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300018009|Ga0187884_10320687All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter626Open in IMG/M
3300018013|Ga0187873_1315305Not Available573Open in IMG/M
3300018014|Ga0187860_1272969Not Available664Open in IMG/M
3300018021|Ga0187882_1125675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1066Open in IMG/M
3300018025|Ga0187885_10029929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60762966Open in IMG/M
3300018025|Ga0187885_10195655Not Available939Open in IMG/M
3300018026|Ga0187857_10138917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1160Open in IMG/M
3300018033|Ga0187867_10031033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae3331Open in IMG/M
3300018034|Ga0187863_10065299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2060Open in IMG/M
3300018042|Ga0187871_10254238All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia975Open in IMG/M
3300018047|Ga0187859_10042263All Organisms → cellular organisms → Bacteria → Acidobacteria2436Open in IMG/M
3300018060|Ga0187765_10333439Not Available919Open in IMG/M
3300019082|Ga0187852_1145161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1011Open in IMG/M
3300019230|Ga0181501_1119792All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1204Open in IMG/M
3300023091|Ga0224559_1019582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2877Open in IMG/M
3300023258|Ga0224535_1010946All Organisms → cellular organisms → Bacteria → Acidobacteria2215Open in IMG/M
3300025412|Ga0208194_1055766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia607Open in IMG/M
3300025480|Ga0208688_1052622Not Available874Open in IMG/M
3300027854|Ga0209517_10188801All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300027905|Ga0209415_10000624All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus66266Open in IMG/M
3300027905|Ga0209415_10132467All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2580Open in IMG/M
3300028565|Ga0302145_10012641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60763147Open in IMG/M
3300028572|Ga0302152_10169023Not Available703Open in IMG/M
3300028574|Ga0302153_10089205All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300028783|Ga0302279_10151702All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1147Open in IMG/M
3300028785|Ga0302201_10252029All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300028800|Ga0265338_10303062All Organisms → cellular organisms → Bacteria1161Open in IMG/M
3300028867|Ga0302146_10146755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia951Open in IMG/M
3300029922|Ga0311363_10121100All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3487Open in IMG/M
3300030000|Ga0311337_10718958Not Available864Open in IMG/M
3300030506|Ga0302194_10328069All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300030659|Ga0316363_10426045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia513Open in IMG/M
3300031344|Ga0265316_10353825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter1063Open in IMG/M
3300032160|Ga0311301_10839378All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1252Open in IMG/M
3300032160|Ga0311301_11990109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia679Open in IMG/M
3300032770|Ga0335085_10836623Not Available1009Open in IMG/M
3300032783|Ga0335079_10683009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1074Open in IMG/M
3300032783|Ga0335079_10916073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia900Open in IMG/M
3300032805|Ga0335078_10010933All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus13447Open in IMG/M
3300032805|Ga0335078_10027315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8466Open in IMG/M
3300032805|Ga0335078_10968087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1012Open in IMG/M
3300032828|Ga0335080_10404483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1464Open in IMG/M
3300033743|Ga0334844_096726Not Available580Open in IMG/M
3300033818|Ga0334804_022141All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2176Open in IMG/M
3300033822|Ga0334828_001944All Organisms → cellular organisms → Bacteria → Acidobacteria9729Open in IMG/M
3300033977|Ga0314861_0017212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4715Open in IMG/M
3300033982|Ga0371487_0014842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5771Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland26.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland15.84%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog13.86%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil13.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.93%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog6.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.95%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.98%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.98%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.99%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.99%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.99%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.99%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016698Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016700Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019230Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033743Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 5-9EnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1014828423300001356Peatlands SoilMTHDAKFEWWILAAIGLGLIVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDAQDAVPLPLSAETVKIECGPDCEIWLAPEDPSTFFQDMARHTPHLRRCGQALKKMWA*
Ga0116128_111502823300009518PeatlandMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAYRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPPTFFQDMARHTPHLRRCGQALTRARV*
Ga0116108_107935123300009519PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRP*
Ga0116136_101661533300009547PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAYRLIPYRAITYIGEDAEQRAPLPLSAETVKIECGPNCEIWLAPEDPSSFFQDMARHTPHLRRRGQALTAAWV*
Ga0116136_112375313300009547PeatlandGSGPAPKMARRASRMPVVYPFRPLTNEKPIMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDAAPLPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRP*
Ga0116133_110311023300009623PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWISGAVMIVLLIRAYPQRYVTTPEGLLIRAGLANRLIPYRAITYIGEDAENAAPLPLSAETVKIECGPHCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA*
Ga0116114_101973633300009630PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV*
Ga0116114_114762623300009630PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAKRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQA
Ga0116115_113637323300009631PeatlandMTHDAKFERWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV*
Ga0116126_109478813300009640PeatlandMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV*
Ga0116126_114014323300009640PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAKRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA*
Ga0116120_108823823300009641PeatlandMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGAVMLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV*
Ga0116110_101671213300009643PeatlandMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGAVMLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDAAPLPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRP*
Ga0116121_104954013300009644PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWISGAVMIVLLIRAYPQRYVTTPEGLLIRAGLANRLIPYRAITYIGEDAENAAPLPLSAETVKIECGPHCEIWLAPEDP
Ga0116106_104410633300009645PeatlandHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV*
Ga0116219_1028230323300009824Peatlands SoilMTHDAKFEWWILAAIGLGLIVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDAQDAVPLPLSAETVKIECGPDCEIWLAPEDPSTFFQDMARHTPHLRRCGQALKKVWA*
Ga0116223_1048121313300009839Peatlands SoilMTHDAKFEWWILAAIGLGLIVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDAQDAVPLPLSAETVKIECGPDCEIWLAPEDPST
Ga0116223_1088363613300009839Peatlands SoilIGLGLLVILAGGNPWIAGSVLPVLLIRAYPQRYVTTKDGLLIRAGLAHRLIPYPAITYIGEDAEDRTPLPLSAETVRIECGPDCEIWLAPEDPSRFFQDMARHTPHLRRRGQALTKAWA*
Ga0074046_1018675623300010339Bog Forest SoilMTHDAKFEWWILAAIGLGLLVILAGGNPWIAGSVLPVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYPAITYIGQDAENQAPVPLSAETVKIECGPNCAIWLAPEDPSTFFQDMARHTPHLRRCGQALRRVWA*
Ga0136449_10070479933300010379Peatlands SoilMTHDAKFEWWVLAAIGLGLLVILAGGNPWIAGSVLPVLLIRAYPQRYVTTKDGLLIRAGLAHRLIPYPAITYIGEDAEDRTPLPLSAETVRIECGPDCEIWLAPEDPSRFFQDMARHTPHLRRRGQALTKAWA*
Ga0136449_10071977733300010379Peatlands SoilMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLILLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPLPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKVWV*
Ga0136449_10352009523300010379Peatlands SoilMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPLPLSPETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV*
Ga0136449_10420260413300010379Peatlands SoilTGRPAPKMAAPGREKLGVSPFRPAKTGILFMTHDAKIEWWILAAIGLGLVVILAGGNHWIAGSVLLVLLIRAYPQRYVTTKDGLLIRAGLANRLIPYRAITYIGEDAEDRAPLPLSAETVRIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKVWV*
Ga0181539_108641233300014151BogMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA*
Ga0181533_108506133300014152BogMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAKRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKAWV*
Ga0181527_106692213300014153BogMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKVWA*
Ga0181517_1000199093300014160BogMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDRAPVPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTKAWV*
Ga0181517_1031059013300014160BogMTHDAKFEWWILAAIGLGLLVILSGGNPWIAGSVLPVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYPAITYIGEDAEDRAPAPLTAETVKIECGPNCEIWLAPEDPSIFFQDMARHTPHLRRCGQALRRVWA*
Ga0181517_1038079613300014160BogMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRAWV*
Ga0181532_1015257223300014164BogMTHDAKFEWWILAAIGLGLVVILAGGNHWIAGSVLPILLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDMEEPAPLALSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRRGQELTKAWV*
Ga0181523_1044321923300014165BogGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAKRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA*
Ga0181528_1088557623300014167BogGNHWISGAVMIVLLIRAYPQRYVTTPEGLLIRAGLANRLIPYRAITYIGEDAENAAPLPLSAETVKIECGPHCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA*
Ga0181535_1006150433300014199BogMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDRAPVPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHRPHLRRRGQALTKAWV*
Ga0181535_1011148733300014199BogMTHDAKFEWWILAAIGLGLIVILAGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDAEDTTPLPLSAETVKIECGPYCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTAGWV*
Ga0182016_1024179823300014493BogMTHDAKFEWWILAALGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV*
Ga0181516_1010954323300014655BogMTHDAKFEWWILAAIGLSLLVILSGGNFWIAGSVLPVLLVRAYPQRYVTRPDGLLIRAGLAHRLIPYPAITYIGEDAADGTPAPLAAETVKIECGPDCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTRVWA*
Ga0182027_1204264413300014839FenMTHDAKFEWWIMAAIGLSLLVILSGGNFWIAGSVLPVLLIRAYPQRYVTRPDGLLIRAGLAHRLIPYPAITYIGEDAEDRAPAPLAAETVKIECGPDCAIWLAPEDPSTFFQDMARHTPHLRRRGQALTRGWA*
Ga0181503_117888713300016698PeatlandAIGLGLVVILVGGNHWISGAVMIVLLIRAYPQRYVTTPEGLLIRAGLANRLIPYRAITYIGEDAENAAPLPLSAETVKIECGPHCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0181513_107232623300016700PeatlandGLVVILVGGNHWISGAVMIVLLIRAYPQRYVTTPEGLLIRAGLANRLIPYRAITYIGEDAENAAPLPLSAETVKIECGPHCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0181511_105425723300016702PeatlandLAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDRAPVPLSAETVKIECGPNCEIWLAPEDPPTFFQDMARHTPHLRRCGQALTRARV
Ga0181505_1057833413300016750PeatlandIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAKRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV
Ga0187856_100753963300017925PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAYRLIPYRAITYIGEDAEQRAPLPLSAETVKIECGPNCEIWLAPEDPSSFFQDMARHTPHLRRRGQALTAAWV
Ga0187848_1000602373300017935PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAKRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0187854_1029300023300017938PeatlandMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV
Ga0187853_1021883923300017940PeatlandMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGAVMLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDAAPLPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRP
Ga0187853_1022907923300017940PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV
Ga0187879_1008632923300017946PeatlandMTRDTKFMTHDAKFEWWILAAIGLGLVVILVGGNHWISGAVMIVLLIRAYPQRYVTTPEGLLIRAGLANRLIPYRAITYIGEDAENAAPLPLSAETVKIECGPHCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0187847_1002003433300017948PeatlandMTHDAKFEWWILAAIGLGLIVILAGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDAEDTTPLPLSAETVKIECGPYCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTAGWV
Ga0187847_1037946523300017948PeatlandEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV
Ga0187782_1001283913300017975Tropical PeatlandMTHDAKFEWWTVAAIGLGLIVILAGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDFAEAPPVALSAETVRLECGPHCEIWLAPEDPAAFFQDMARRAPHLRRRGQALRAAWA
Ga0181520_1001599473300017988BogMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDRAPVPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTKAWV
Ga0181520_1022769633300017988BogLAPRMEHGAGVRSTCVCPARQETESYFMTHDAKFEWWILAAIGLGLLVILSGGNPWIAGSVLPVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYPAITYIGEDAEDRAPAPLTAETVKIECGPNCEIWLAPEDPSIFFQDMARHTPHLRRCGQALRRVWA
Ga0187870_127199213300017998PeatlandEGQAQGRVTINSQGENGSRPGAHNGAPGEQKPVVCPFRPAQTGTSFMTRDTKFMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPEGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0187865_127670613300018004PeatlandFMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV
Ga0187884_1032068713300018009PeatlandMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSPFFQDMARHTPHLRRRGQALTRARV
Ga0187873_131530513300018013PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLATRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0187860_127296913300018014PeatlandMPVVYPFRPLTNEKPIMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAKRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0187882_112567523300018021PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFF
Ga0187885_1002992933300018025PeatlandWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAKRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKAWV
Ga0187885_1019565523300018025PeatlandMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGAVMLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDAAPLPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRR
Ga0187857_1013891713300018026PeatlandMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQD
Ga0187867_1003103323300018033PeatlandMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRAWV
Ga0187863_1006529923300018034PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPPTFFQDMARHTPHLRRCGQALTRARV
Ga0187871_1025423823300018042PeatlandFMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPPTFFQDMARHTPHLRRCGQALTRARV
Ga0187859_1004226323300018047PeatlandMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDVEDATPPPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0187765_1033343923300018060Tropical PeatlandMTHDAKFEWWTLAAIGLGLVVILAGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEEGMDAAPLPLTAETVKIECGPNCEIWLAPEDPLSFFQDMARHTPHLRRCGQVLTVGRV
Ga0187852_114516123300019082PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKVWA
Ga0181501_111979223300019230PeatlandGLGLVVILVGGNHWISGAVMIVLLIRAYPQRYVTTPEGLLIRAGLANRLIPYRAITYIGEDAENAAPLPLSAETVKIECGPHCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0224559_101958233300023091SoilMTHDAKFEWWIMAAIGLSLLVILSGGNFWIAGSVLPVLLVRAYPQRYVTRPDGLLIRAGLAHRLIPYPAITYIGEDAADRTPAPLAAETVKIECGPDCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTRGWA
Ga0224535_101094623300023258SoilMTHDAKFEWWILAAIGLSLLVILSGGNFWIAGSVLPVLLVRAYPQRYVTRPDGLLIRAGLAHRLIPYPAITYIGEDAADRTPAPLAAETVKIECGPDCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTRGWA
Ga0208194_105576613300025412PeatlandFMTRDTKFMTHDAKFEWWILAAIGLGLVVILVGGNHWISGAVMIVLLIRAYPQRYVTTPEGLLIRAGLANRLIPYRAITYIGEDAENAAPLPLSAETVKIECGPHCEIWLAPEDPSMFFQDMARHTPHLRRCGQALRKVWA
Ga0208688_105262213300025480PeatlandMTHDAKFEWWILAAIGLGLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAALPLSAETVKIECGPNCEIWLAPEDPSTFFQDMA
Ga0209517_1018880123300027854Peatlands SoilMTHDAKFEWWILAAIGLGLIVILVGGNHWIAGAVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDGEDAVALPLSAETVKIECGPNCEIWLAPEDPLTFFQDMARHTPHLRRCGQALKKAWA
Ga0209415_1000062493300027905Peatlands SoilMTHDAKFEWWILAAIGLGLIVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDAQDAVPLPLSAETVKIECGPDCEIWLAPEDPSTFFQDMARHTPHLRRCGQALKKMWA
Ga0209415_1013246733300027905Peatlands SoilMTHDAKFEWWVLAAIGLGLLVILAGGNPWIAGSVLPVLLIRAYPQRYVTTKDGLLIRAGLAHRLIPYPAITYIGEDAEDRTPLPLSAETVRIECGPDCEIWLAPEDPSRFFQDMARHTPHLRRRGQALTKAWA
Ga0302145_1001264113300028565BogVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV
Ga0302152_1016902313300028572BogMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFF
Ga0302153_1008920513300028574BogMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMA
Ga0302279_1015170213300028783BogFMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV
Ga0302201_1025202923300028785BogTSFMTHDTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV
Ga0265338_1030306223300028800RhizosphereMTHDAKFEWWILAAIGLGLIVILVGGNHWIAGSVLLILLIRAYPQRYVTTKDGLLIRAGLANRLIPYRAITYIGEDLEETATLPLSAETVKIECGPNCEIWLAPEDPSMF
Ga0302146_1014675513300028867BogWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV
Ga0311363_1012110013300029922FenTKFMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV
Ga0311337_1071895823300030000FenMAAIGLSLLVILSGANFWIAGSVLPVLLIRAYPQRYVTRPDGLLIRAGLAHRLIPYPAITYIGEDAEDRAPAPLAAETVKIECGPDCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTRGWA
Ga0302194_1032806923300030506BogHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV
Ga0316363_1042604513300030659Peatlands SoilLVILAGGNPWIAGSVLPVLLIRAYPQRYVTTKDGLLIRAGLAHRLIPYPAITYIGEDAEDRTPLPLSAETVRIECGPDCEIWLAPEDPSRFFQDMARHTPHLRRCGQALRKVWA
Ga0265316_1035382513300031344RhizosphereESQLCIRSAQPKTGILLMTHDAKFEWWILAAIGLGLIVILVGGNHWIAGSVLLILLIRAYPQRYVTTKDGLLIRAGLANRLIPYRAITYIGEDLEETATLPLSAETVKIECGPNCEIWLAPEDPSMFFQDMARHTPHLRRRGQALTRVWA
Ga0311301_1083937813300032160Peatlands SoilLIVILVGGNHWIAGAVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDGEDAVALPLSAETVKIECGPNCEIWLAPEDPLTFFQDMARHTPHLRRCGQALKKAWA
Ga0311301_1199010913300032160Peatlands SoilRQKTVVSPLRPTKTGFLFMTHDAKIEWWILAAIGLGLVVILAGGNHWIAGSVLLVLLIRAYPQRYVTTKDGLLIRAGLANRLIPYRAITYIGEDAEDRAPLPLSAETVRIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKVWV
Ga0335085_1083662323300032770SoilMTHDAKFEWWILAAIGLGLIVILAGGNHWIAGSVLLILLIRAYPQRYVTTPDGLLIRAGLTHRLIPYRAITYIGEDAEDAVQLPLSAETVKIECGPNCEIWLAPEDPTTFFQDMARHTPHLRRRGQALTAGWV
Ga0335079_1068300913300032783SoilAGKASSVPVALQPTGILHMTHDAKFEWWILAAIGLGLIVILAGGNHWIAGSVLLILLIRAYPQRYVTTPDGLLIRAGLTHRLIPYRAITYIGEDAEDAVQLPLSAETVKIECGPNCEIWLAPEDPTTFFQDMARHTPHLRRRGQALTAGWV
Ga0335079_1091607323300032783SoilMTHDAKFEWWTLAAIGLGLVVILMGGNQWIAGAVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDTEDAAPAPLSPETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKVWS
Ga0335078_1001093343300032805SoilMTHDAKFEWWILAAIGLGLIVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLAHRLIPYRAITYIGEDAEAAAPGALSPETVRIECGPHCQIWLAPEDPSTFFQDMARRAPHLRRYGQALRAGWA
Ga0335078_1002731523300032805SoilMTHDAKFEWWTLAAIGLGLVVILVGGNHWIAGAVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEGAAPAPLSPETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKVWS
Ga0335078_1096808723300032805SoilMTHDAKFEWWTLAAIGLGLVVILMGGNQWIAGAVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDTEDAAPAPLSPETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKVWA
Ga0335080_1040448323300032828SoilMTHDAKFEWWTLAAIGLGLVVILAGGNHWIAGSVLVILLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDTQDAAAAPLTAETVRIECGPDCEIWLAPEDPSTFFQDMARHTPHLLLRGRALMKAWA
Ga0334844_096726_38_4393300033743SoilMTHDAKFEWWILAAIGFGLVVMLAGGNPWIAGSVLPVLLIRVYPQRYVTTKDGLLIRAGLAHRLIPYPAITYIGEDAEEGATAPLTAETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTRGWG
Ga0334804_022141_1831_21753300033818SoilMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMA
Ga0334828_001944_7984_83853300033822SoilMTHDAKFEWWILAAIGLSLVVILVGGNHWIAGSVLLVLLIRAYPQRYVTTPDGLLIRAGLANRLIPYRAITYIGEDAEDTAPPPLSAETVRIECGPNCEIWLAPQDPSTFFQDMARHTPHLRRRGQALTRARV
Ga0314861_0017212_4323_47153300033977PeatlandMTHDAKFEWWTLAAIGLGLVVILVGGNHWIAGAVLLVLLIRAYPQRYVTTPDGLLIRAGLAYRLIPYRAITYIGEDAEGEVPAPLSSETVKIECGPNCEIWLAPEDPSTFFQDMARHTPHLRRCGQALRKV
Ga0371487_0014842_1576_19773300033982Peat SoilMTHDAKFEWWILAAIGLSLLVILSGGNFWIAGSVLPVLLVRAYPQRYVTRPDGLLIRAGLAHRLIPYPAITYIGEDAADGTPAPLAAETVKIECGPDCEIWLAPEDPSTFFQDMARHTPHLRRRGQALTRVWA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.