 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F102341 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ADATDAIIPTMMKSLMQGASFTATVNKANTELQNVLNTGSES |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 7.92 % |
| % of genes from short scaffolds (< 2000 bps) | 6.93 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (94.059 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.782 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.634 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.366 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 38.61 |
| PF00933 | Glyco_hydro_3 | 2.97 |
| PF08044 | DUF1707 | 1.98 |
| PF00072 | Response_reg | 0.99 |
| PF00689 | Cation_ATPase_C | 0.99 |
| PF13560 | HTH_31 | 0.99 |
| PF02464 | CinA | 0.99 |
| PF08494 | DEAD_assoc | 0.99 |
| PF00480 | ROK | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 2.97 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.98 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.99 |
| COG1201 | Lhr-like helicase | Replication, recombination and repair [L] | 0.99 |
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 94.06 % |
| All Organisms | root | All Organisms | 5.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101820760 | Not Available | 510 | Open in IMG/M |
| 3300005436|Ga0070713_101705432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 611 | Open in IMG/M |
| 3300010366|Ga0126379_13614240 | Not Available | 518 | Open in IMG/M |
| 3300011120|Ga0150983_12437793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1713 | Open in IMG/M |
| 3300021171|Ga0210405_10669542 | Not Available | 804 | Open in IMG/M |
| 3300021479|Ga0210410_10072288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3025 | Open in IMG/M |
| 3300026217|Ga0209871_1000108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 26194 | Open in IMG/M |
| 3300031781|Ga0318547_10904679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 551 | Open in IMG/M |
| 3300032160|Ga0311301_10601611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.95% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.98% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.98% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.99% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027080 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF009 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1018207601 | 3300002245 | Forest Soil | SKNWATADATDAIIPTMMKSLMQGADFSATVNKANTQLQNVLNTGSETG* |
| Ga0070683_1006126192 | 3300005329 | Corn Rhizosphere | KNWATADATDAIIPDMMKALMQGANFSSTVSKANTELQNVLNTGKK* |
| Ga0070714_1005698542 | 3300005435 | Agricultural Soil | DTTDAIIPTMMKALMQGANFTQTVNKANTALQNVLNTGKM* |
| Ga0070713_1017054322 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LNSKNWGIADTTDAIIPTMMKALMQGANFTQTVNKANTALQNVLNTGKM* |
| Ga0070710_110022501 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | IADTTDAIIPTMMKALMQGANFTQTVDKANAALQNVLNTGKM* |
| Ga0070693_1006076422 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | WAAADAQDAIIPTMMKALMQGANFTATVNKANTQLQNVLNTGSESG* |
| Ga0070761_106387322 | 3300005591 | Soil | DATDAIIPTMMKSLMQGASFSATVNKANTELQNVLNTGSES* |
| Ga0070762_102136801 | 3300005602 | Soil | ATDQIIPDMMKALMQGANFTTTVNTANTELQNVLNTGSES* |
| Ga0070763_102560432 | 3300005610 | Soil | TTDAIIPTMMKALMQGANFTQTVNKANTALQNVLNTGKM* |
| Ga0070763_105084372 | 3300005610 | Soil | TDYVIPTMIKSLMNGAPLAATVSKANTQLQNILNTGSES* |
| Ga0066903_1029548221 | 3300005764 | Tropical Forest Soil | TADATDQIIPTMMKQLMNGAPFAATVSKANTQLENVLNTGSEG* |
| Ga0080026_100004771 | 3300005952 | Permafrost Soil | NSKNWATADATDAIIPTMMKSLMQGANFTATVNKANTELQNVLNTGSES* |
| Ga0070717_118975661 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IIPTMMKALMQGANFTATVNKANTQLQNVLNTGSESG* |
| Ga0116218_11397212 | 3300009522 | Peatlands Soil | MMKSLMQGASFTATVDNANPQRQNVLSTGSRSGARHVA |
| Ga0126384_121986231 | 3300010046 | Tropical Forest Soil | KNWSTADATDAIIPTMMKALMRGAPFAATVAQANTQLESVLNTGQQS* |
| Ga0126373_102353163 | 3300010048 | Tropical Forest Soil | ADATDQIIPNMMKALMQGANFAATVNKANTELQNVLNTGSES* |
| Ga0126373_103644301 | 3300010048 | Tropical Forest Soil | TADATDAIIPTMMKALDRGANFQSTVAQANTELQNVLNTGKES* |
| Ga0126373_121684741 | 3300010048 | Tropical Forest Soil | IADTTVAVIPTMMKALMQGANFTQTVDKANTDLQNVLNTGKP* |
| Ga0126373_132290902 | 3300010048 | Tropical Forest Soil | YNIIPNMMKALESGADFNSTVSAANTQLQTVLNTGSE* |
| Ga0134082_102672892 | 3300010303 | Grasslands Soil | DAIIPTMMKALMQGANFSQTVDKANIALQNVLNTGKM* |
| Ga0126376_107966902 | 3300010359 | Tropical Forest Soil | NWGTADATDQIIPTMMKALDQGKDFNATVAQANTELQNVLNTGQES* |
| Ga0126376_119997342 | 3300010359 | Tropical Forest Soil | DTGKYNIIPNMMKALESGADFQSTVSAANTQLQTVLNTGSE* |
| Ga0126372_116443092 | 3300010360 | Tropical Forest Soil | GTADATDQIIPDMMKSLMQGASFTATVNKANTELQNVLNTGNES* |
| Ga0126378_129784962 | 3300010361 | Tropical Forest Soil | GIADTTDAIIPTMMKALMQGANFTQTVNKANSELQNVLNTGKM* |
| Ga0126379_136142402 | 3300010366 | Tropical Forest Soil | LNSKNWGIADTTDAIIPTMMKALMQGANFTDTVNKANTALQNVLNTGKM* |
| Ga0126381_1002930961 | 3300010376 | Tropical Forest Soil | ADATDQIIPGMMKALMQGANFTATVNKANTQLQNVLNTGSES* |
| Ga0126381_1006329171 | 3300010376 | Tropical Forest Soil | TGKYNIIPNMMKALESGADFNSTVSQANTQLQAVLNTGSE* |
| Ga0126381_1020928731 | 3300010376 | Tropical Forest Soil | AVIPTMMKALMQGANFSQTVDQANTELQNILNTGKK* |
| Ga0126381_1022218052 | 3300010376 | Tropical Forest Soil | DTTDAVIPTMMKALMQGANFSQTVDQANTELQNILNTGKK* |
| Ga0136449_1030067801 | 3300010379 | Peatlands Soil | KNWATADATDAIIPTMMKSLMLGANFTATVSKSNTELQNVLNTGSETG* |
| Ga0136449_1041343482 | 3300010379 | Peatlands Soil | IPTMMKALDRGATFQSTVAQANTQLQNVLNTGQES* |
| Ga0126383_117919041 | 3300010398 | Tropical Forest Soil | DATDQIIPNMMKALMQGASLTATVNKANTELQNVLNTGSES* |
| Ga0126361_110142331 | 3300010876 | Boreal Forest Soil | ADSTDYVIPTMVKSLMNGAPFAATVSKANTELQNVLNTGSES* |
| Ga0126361_112248741 | 3300010876 | Boreal Forest Soil | QIIPTMMKALMQGANFSSTVSKANTQMQNVLNTGKSS* |
| Ga0126356_101285452 | 3300010877 | Boreal Forest Soil | DAIIPTMMKSLMQGANFSATVSKANTELQNVLNTGSETG* |
| Ga0137776_10075001 | 3300010937 | Sediment | IPTMMKALDRGANFQATVSQANTELQNVLNTGQEG* |
| Ga0150983_124377932 | 3300011120 | Forest Soil | MNNKNWGTADTSQYNIIPNMMKALESGANFQATVSKANTELQNVLNTGTETG* |
| Ga0137391_105532901 | 3300011270 | Vadose Zone Soil | TDAIIPTMMKALMQGANFTQTVDKANTELQNVLNTGKM* |
| Ga0137391_114486842 | 3300011270 | Vadose Zone Soil | ADTTDQIIPTMMKALMQGAPFQATVSKANTEMQNVLNTGKES* |
| Ga0137365_102519551 | 3300012201 | Vadose Zone Soil | QIIPTMMKQIMNGAPVAATVSKANAKLQDVLNAGS* |
| Ga0137380_101827512 | 3300012206 | Vadose Zone Soil | ADATDAIIPTMMKSLMQGASFTATVNKANTELQNVLNTGSES* |
| Ga0137380_106013642 | 3300012206 | Vadose Zone Soil | DATDAIIPTMMKSIMRGANFSAAVAKANTQLQNVLNTGSQ* |
| Ga0137377_104562031 | 3300012211 | Vadose Zone Soil | IADTTDAIIPTMMKALMQGANFTQAVNKANTELQNVLNTGKM* |
| Ga0137369_100756831 | 3300012355 | Vadose Zone Soil | TADATDQIIPTMMKQIMNGAPVAATVSKANAKLQDVLNAGS* |
| Ga0137371_109996291 | 3300012356 | Vadose Zone Soil | TTDAIIPTMMKALMQGANFTQTVDKANTELQNVLNTGKV* |
| Ga0137390_112343803 | 3300012363 | Vadose Zone Soil | DATDAIIPTMMKALMQGANFTATVNKANSQLQNVLNTGKES* |
| Ga0181526_104298391 | 3300014200 | Bog | ADTTDQIISAMMKSLVQGANFTATVDNANTRRRNVLNTGSKS* |
| Ga0182033_119374391 | 3300016319 | Soil | TADATDAIIPTMMKALDRGADFATTVSQANTKLQNVLNTGQEG |
| Ga0182034_109454022 | 3300016371 | Soil | ADTTDAIIPTMMKALMQGANFTQAVDKANTALQNVLNTGKV |
| Ga0182034_116011282 | 3300016371 | Soil | DAVIPTIMKALMQGANFSQTGDQANTELQNILNTGKK |
| Ga0187825_101153451 | 3300017930 | Freshwater Sediment | TADTGKYNIIPNMMKALESGADFQSTVSQANTQLQAVLNTGSE |
| Ga0187783_110118921 | 3300017970 | Tropical Peatland | TDNIIPNMMKALMQGANFTTTVNTANTELQNVLNTGSES |
| Ga0187805_100029819 | 3300018007 | Freshwater Sediment | KYNIIPNMMKALESGADFQSTVSQANTQLQAVLNTGSE |
| Ga0210399_103616402 | 3300020581 | Soil | TADATDAIIPTMMKEIMRGANFQSTVAQANTQLQNVLNTGQES |
| Ga0210405_106695422 | 3300021171 | Soil | LNSKNWGIADTTDAIIPTMMKALMQGANFTQTVDKANTALQNVLNTGKM |
| Ga0210388_100694594 | 3300021181 | Soil | TDYVIPTMVKSLMNGAPLAATVSKANTELQNVLNTGSES |
| Ga0210388_103630211 | 3300021181 | Soil | STADATDAIIPTMMKALDRGANFSTTVAQANTQLQNVLNTGQES |
| Ga0210388_111086151 | 3300021181 | Soil | DYVIPTMIKALMKGAPFAATVAKANTELANVLNTGNES |
| Ga0210385_102331101 | 3300021402 | Soil | DIIPDMMKSLEEGANFTATVNKANTELQNVLNTGNES |
| Ga0210397_100638871 | 3300021403 | Soil | IPTMIKSLMNGAPLAATVSKANTELQNVLNTGSES |
| Ga0210389_109762182 | 3300021404 | Soil | IIPTMLKSLMQGAPFASTVASANTQLQNVLNTGSAS |
| Ga0210387_110093301 | 3300021405 | Soil | DATDQIIPDMMKSLMQGANFTATVNKANTELQNVLNTGSES |
| Ga0210394_110259622 | 3300021420 | Soil | STDYVIPTMIKSLMNGAPLAATVSKANTELQNVLNTGSES |
| Ga0210390_100316785 | 3300021474 | Soil | WATADATDAIIPTMMKSLMQGASLTATVNKANTELQNVLNTGSES |
| Ga0210390_112184522 | 3300021474 | Soil | TDAIIPNMMKSLMQGANFSATVNKANTQLQNMLNTGSETG |
| Ga0210410_100722881 | 3300021479 | Soil | NWSTADATDAIIPTMMKALDRGANFSTTVAQANTQLQNVLNTGQES |
| Ga0126371_120097331 | 3300021560 | Tropical Forest Soil | LNSKNWGTADATDQIIPNMMKALMQGANFAATVNKANTELQNVLNTGSES |
| Ga0242656_11062662 | 3300022525 | Soil | GTADISKYNIIPTMMKDLMDGANFQATVQKANTELQDVLNTGSES |
| Ga0208586_10220363 | 3300025588 | Arctic Peat Soil | AIIPTMMKSLMQGANFSATVSKANTELQNVLNTGSETG |
| Ga0208586_10362801 | 3300025588 | Arctic Peat Soil | AIIPTMMKSLMQGANFSATVSKANTELQNVLNSGSETG |
| Ga0207684_109019622 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TTDAIIPTMMKALMQGANFTQTVDKANAALQNVLNTGKM |
| Ga0207663_106243531 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VIPTMMKALMQGANFSQTVGQANTELQNILNTGKK |
| Ga0209871_10001081 | 3300026217 | Permafrost Soil | NSKNWATADATDAIIPTMMKSLMQGANFTATVNKANTELQNVLNTGSES |
| Ga0208237_10093463 | 3300027080 | Forest Soil | NWATADATDAIIPTMMKSLMQGGNFAATVSKANTELQNVLNTGSES |
| Ga0209274_103099261 | 3300027853 | Soil | DATDAIIPTMMKSLMQGASLTATVNKANTELQNVLNTGSES |
| Ga0209169_106330061 | 3300027879 | Soil | DATDEIIPNMMKALMQGANFQATVSKANTLLQNVLNTGSES |
| Ga0209590_106071252 | 3300027882 | Vadose Zone Soil | IIPTMMKALMQGANFTQTVDKANTELQNVLNTGKV |
| Ga0209275_101662262 | 3300027884 | Soil | ATDQIIPDMMKALMQGANFTTTVNTANTELQNVLNTGSES |
| Ga0209380_101441543 | 3300027889 | Soil | TDAIIPTMMKSLMQGASFTATVNKANSELQNVLNTGSES |
| Ga0209624_104052852 | 3300027895 | Forest Soil | AIIPTMMKSLMQGGNFAATVNKANTELQNVLNTGSET |
| Ga0209415_102947963 | 3300027905 | Peatlands Soil | STDYVIPTMIKSLMNGAPFAATVSKANTQLQNVLNTGSES |
| Ga0302232_101417521 | 3300028789 | Palsa | TDYVIPTMIKSLMNGANFASTVSKANTELANVLNTGNES |
| Ga0311327_108878661 | 3300029883 | Bog | ISPTMMKSLMQDAKFTATVNKANTQLQNVLNTGSQS |
| Ga0311326_100232444 | 3300029917 | Bog | QIIPTMMKSLMQDAKFTATVNKANTQLQNVLNTGSQS |
| Ga0311371_102240451 | 3300029951 | Palsa | DYVIPTMVKSLMNGANFASTVSKANTELQNVLNTGNES |
| Ga0302305_13213542 | 3300030046 | Palsa | ATDAIIPTMMKALDRGANFAATVSQANTELQNVLNTGQES |
| Ga0311370_111910362 | 3300030503 | Palsa | WATADATDQIIPNMMKALMQGANFSATVSKANTELQNVLNTGSES |
| Ga0311372_119982172 | 3300030520 | Palsa | ADSTDYVIPTMVKSLMNGANFASTVSKANTELQNVLNTGNES |
| Ga0318534_108028062 | 3300031544 | Soil | SKNWGIADTTDAIIPTMMKALMQGANFSQTVDKANTALQNVLNTGKM |
| Ga0310686_1151522921 | 3300031708 | Soil | KNWATADATDQIIPTMMKALMQGANFSATVSKANTQLQNVLNTGSGSS |
| Ga0318496_102073741 | 3300031713 | Soil | WAIADATDAIIPTMMKALMQGANFTQTVNTANTDLQNVLNTGKP |
| Ga0318521_102944312 | 3300031770 | Soil | NWGIADTTDAIIPTMMKALMQGANFSQTVDKANTALQNVLNTGKM |
| Ga0318547_109046791 | 3300031781 | Soil | NAKNWAIADTTDAVIPTMMKALMQGANFSQTVDQANTELQNILNTGKK |
| Ga0318522_103930951 | 3300031894 | Soil | IPTMMKALMRGAPFAATVAQANTQLENVLNTGQEG |
| Ga0318520_108121792 | 3300031897 | Soil | NWAIADTTVAVIPTMMKALMQGANFTQTVDKANTDLQNVLNTGKP |
| Ga0306921_110146981 | 3300031912 | Soil | VAVIPTMMKALMQGANFTQTVDKANTDLQNVLNTGKP |
| Ga0318531_100451111 | 3300031981 | Soil | ATDAIIPTMMKALMRGAPFAATVAQANTQLENVLNTGQEG |
| Ga0318507_102926682 | 3300032025 | Soil | TTDAVIPTMMKALMQGANFSQTVDQANTELQNILNTGKK |
| Ga0311301_106016113 | 3300032160 | Peatlands Soil | NWSTADATDAIIPTMMKALDRGANFQSTVAQANTQLQNVLNTGQES |
| Ga0335078_100723677 | 3300032805 | Soil | QDAIIPTMMKALMQGANFTATVNKANTQLQNVLNTGSESG |
| Ga0335074_116244312 | 3300032895 | Soil | DQIIPNMMKALMQGANFTSTVNKANTELQNVLNTGNES |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |