| Basic Information | |
|---|---|
| Family ID | F102164 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | ERASAADLVRRLATVPPALAQLFASIAASDATHVTALGG |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 98.04 % |
| % of genes from short scaffolds (< 2000 bps) | 92.16 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.627 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.196 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.490 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.922 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF14530 | DUF4439 | 83.33 |
| PF01425 | Amidase | 8.82 |
| PF13538 | UvrD_C_2 | 2.94 |
| PF03551 | PadR | 0.98 |
| PF13312 | DUF4081 | 0.98 |
| PF01476 | LysM | 0.98 |
| PF13581 | HATPase_c_2 | 0.98 |
| PF07650 | KH_2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 8.82 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.98 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.98 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.63 % |
| Unclassified | root | N/A | 31.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig112476 | Not Available | 526 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10245538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
| 3300004091|Ga0062387_101292657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300004092|Ga0062389_102033245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
| 3300005541|Ga0070733_10247493 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300005555|Ga0066692_10889685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300005921|Ga0070766_10737934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300006086|Ga0075019_10819753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300009098|Ga0105245_11645738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 694 | Open in IMG/M |
| 3300009098|Ga0105245_12601437 | Not Available | 559 | Open in IMG/M |
| 3300009672|Ga0116215_1458457 | Not Available | 551 | Open in IMG/M |
| 3300009698|Ga0116216_10089678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1893 | Open in IMG/M |
| 3300009698|Ga0116216_10194802 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300009839|Ga0116223_10612354 | Not Available | 628 | Open in IMG/M |
| 3300010361|Ga0126378_10435358 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300010361|Ga0126378_11009627 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300010373|Ga0134128_11464142 | Not Available | 752 | Open in IMG/M |
| 3300010376|Ga0126381_104923634 | Not Available | 513 | Open in IMG/M |
| 3300010398|Ga0126383_11445331 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300010866|Ga0126344_1312392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300010877|Ga0126356_10096654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
| 3300012357|Ga0137384_11239160 | Not Available | 592 | Open in IMG/M |
| 3300012357|Ga0137384_11339526 | Not Available | 563 | Open in IMG/M |
| 3300012955|Ga0164298_11192725 | Not Available | 576 | Open in IMG/M |
| 3300012960|Ga0164301_10455066 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300012989|Ga0164305_12113991 | Not Available | 516 | Open in IMG/M |
| 3300013307|Ga0157372_11333251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
| 3300014169|Ga0181531_10685761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
| 3300017937|Ga0187809_10195522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300017942|Ga0187808_10036693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2041 | Open in IMG/M |
| 3300017943|Ga0187819_10252422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
| 3300017943|Ga0187819_10459080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
| 3300018044|Ga0187890_10756826 | Not Available | 549 | Open in IMG/M |
| 3300018060|Ga0187765_11046384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300018062|Ga0187784_10495134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 985 | Open in IMG/M |
| 3300020579|Ga0210407_10493891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300020579|Ga0210407_10702136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
| 3300020581|Ga0210399_10969651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300021088|Ga0210404_10108256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1412 | Open in IMG/M |
| 3300021180|Ga0210396_10739376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 847 | Open in IMG/M |
| 3300021181|Ga0210388_10580674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
| 3300021405|Ga0210387_11126709 | Not Available | 683 | Open in IMG/M |
| 3300021475|Ga0210392_11264262 | Not Available | 552 | Open in IMG/M |
| 3300021475|Ga0210392_11415864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300021478|Ga0210402_10487250 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300021478|Ga0210402_11197825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300021559|Ga0210409_10361362 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300021559|Ga0210409_10581985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
| 3300024222|Ga0247691_1022696 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300024310|Ga0247681_1003089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1978 | Open in IMG/M |
| 3300025928|Ga0207700_11933426 | Not Available | 516 | Open in IMG/M |
| 3300026356|Ga0257150_1024960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 848 | Open in IMG/M |
| 3300026515|Ga0257158_1003637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2041 | Open in IMG/M |
| 3300027609|Ga0209221_1007956 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
| 3300027648|Ga0209420_1160285 | Not Available | 613 | Open in IMG/M |
| 3300027662|Ga0208565_1129626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300027812|Ga0209656_10036733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2854 | Open in IMG/M |
| 3300027829|Ga0209773_10199528 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300027867|Ga0209167_10147495 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300027867|Ga0209167_10342682 | Not Available | 811 | Open in IMG/M |
| 3300027882|Ga0209590_10692996 | Not Available | 652 | Open in IMG/M |
| 3300027895|Ga0209624_10900830 | Not Available | 577 | Open in IMG/M |
| 3300027898|Ga0209067_10256895 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Taibaiella → Taibaiella soli | 952 | Open in IMG/M |
| 3300028780|Ga0302225_10243967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 858 | Open in IMG/M |
| 3300028780|Ga0302225_10372622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300028879|Ga0302229_10531327 | Not Available | 518 | Open in IMG/M |
| 3300028906|Ga0308309_10107304 | Not Available | 2173 | Open in IMG/M |
| 3300029943|Ga0311340_10167771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2266 | Open in IMG/M |
| 3300029944|Ga0311352_10008219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11150 | Open in IMG/M |
| 3300029999|Ga0311339_10215703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2151 | Open in IMG/M |
| 3300030617|Ga0311356_10293877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1630 | Open in IMG/M |
| 3300031564|Ga0318573_10578528 | Not Available | 605 | Open in IMG/M |
| 3300031668|Ga0318542_10312696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300031713|Ga0318496_10557136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300031718|Ga0307474_11516926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300031747|Ga0318502_10710328 | Not Available | 608 | Open in IMG/M |
| 3300031747|Ga0318502_10977698 | Not Available | 516 | Open in IMG/M |
| 3300031764|Ga0318535_10398525 | Not Available | 614 | Open in IMG/M |
| 3300031765|Ga0318554_10202127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1131 | Open in IMG/M |
| 3300031765|Ga0318554_10546127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300031770|Ga0318521_10657594 | Not Available | 635 | Open in IMG/M |
| 3300031782|Ga0318552_10601494 | Not Available | 561 | Open in IMG/M |
| 3300031795|Ga0318557_10169659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 991 | Open in IMG/M |
| 3300031805|Ga0318497_10072062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1818 | Open in IMG/M |
| 3300031819|Ga0318568_10623375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 671 | Open in IMG/M |
| 3300031819|Ga0318568_11042703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
| 3300031846|Ga0318512_10577434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 572 | Open in IMG/M |
| 3300031846|Ga0318512_10690245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300031896|Ga0318551_10723938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300031941|Ga0310912_11498297 | Not Available | 508 | Open in IMG/M |
| 3300031945|Ga0310913_11303467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300032001|Ga0306922_10855542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300032043|Ga0318556_10387461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
| 3300032044|Ga0318558_10483126 | Not Available | 618 | Open in IMG/M |
| 3300032063|Ga0318504_10266758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 807 | Open in IMG/M |
| 3300032063|Ga0318504_10444127 | Not Available | 620 | Open in IMG/M |
| 3300032065|Ga0318513_10439427 | Not Available | 637 | Open in IMG/M |
| 3300032261|Ga0306920_102670495 | Not Available | 683 | Open in IMG/M |
| 3300032770|Ga0335085_11368375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 743 | Open in IMG/M |
| 3300032895|Ga0335074_11142116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300032897|Ga0335071_11398309 | Not Available | 644 | Open in IMG/M |
| 3300033134|Ga0335073_11041883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.20% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.86% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.94% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0470.00006850 | 2166559005 | Simulated | AERASAADLVRRLATAPPALAQLLASIAASDATHVTALGG |
| JGIcombinedJ51221_102455383 | 3300003505 | Forest Soil | RLRAAERASAAGLVQRLTTVQPALAQLFASIAASDATHVTVLAEAGLGG* |
| Ga0062387_1012926571 | 3300004091 | Bog Forest Soil | ASAAGLVQQLATVEPALAQLFASIAASDATHVTVLTDNGLAEG* |
| Ga0062389_1020332453 | 3300004092 | Bog Forest Soil | ASAAGLVQQLATVEPALAQLFASIAASDATHVTALAGNGLG* |
| Ga0070733_102474933 | 3300005541 | Surface Soil | SADLVRRLGGAEPALAQLFASIAACHATHVAALGG* |
| Ga0066692_108896851 | 3300005555 | Soil | ASAADLVRRLATVPPSLAQLLASIAASDATHVTVLGG* |
| Ga0070766_107379341 | 3300005921 | Soil | ASAAGLVRRLATVEPALAQLFASIAASDATHVAALGG* |
| Ga0075019_108197532 | 3300006086 | Watersheds | LRAAERASAAGLVQRLASVEPALAQLFASIAASDATHVTVLTDNGLAEG* |
| Ga0105245_116457382 | 3300009098 | Miscanthus Rhizosphere | AERASAADLVRRLATAPPALAQLLASIAASDATHVTALGG* |
| Ga0105245_126014372 | 3300009098 | Miscanthus Rhizosphere | RASAADLVRRLATAPPALAQLLASIAASDATHVTALGG* |
| Ga0116215_14584572 | 3300009672 | Peatlands Soil | ASAAGLVQRLATVEPALAQLFASIAASDATHVTVLADNGLAG* |
| Ga0116216_100896784 | 3300009698 | Peatlands Soil | AAERASAAGLVQRLATVEPALAQLFASIAASDATHVTVLADKGLG* |
| Ga0116216_101948023 | 3300009698 | Peatlands Soil | AGLVQQLATVEPALAQLFASIAASDATHVTVLAEKGPG* |
| Ga0116223_106123541 | 3300009839 | Peatlands Soil | LVQRLATVEPALAQLFASIAASDATHVTVLAEKGLE* |
| Ga0126378_104353583 | 3300010361 | Tropical Forest Soil | SAADLVRRLATVPPALAQLFASIAASDATHVTVLGG* |
| Ga0126378_110096273 | 3300010361 | Tropical Forest Soil | SAAGLVQRLASVPPALAQLFASIAASDATHVTVLGG* |
| Ga0134128_114641421 | 3300010373 | Terrestrial Soil | RLRAAERASAASLVRQLGAMPPALAQLFASIAASDATHVTALGG* |
| Ga0126381_1049236341 | 3300010376 | Tropical Forest Soil | RASAAGLVQRLASVPPALAQLFASIAASDATHVTVLGG* |
| Ga0126383_114453313 | 3300010398 | Tropical Forest Soil | AILVQRLDTVPPALAQLFASIAASDATHVTALGG* |
| Ga0126344_13123922 | 3300010866 | Boreal Forest Soil | SAADLVRRLGSVPPALAQLFASIAASDATHVAALGG* |
| Ga0126356_100966543 | 3300010877 | Boreal Forest Soil | LRAAEHASAGRLVQQLATVEPALAQLFASIAPSDATHVTALGG* |
| Ga0137384_112391602 | 3300012357 | Vadose Zone Soil | ARVTVARLHAAERASAADLVQRLATVPPALAQLFASIAASDATHVTVLGG* |
| Ga0137384_113395261 | 3300012357 | Vadose Zone Soil | AELVQRLSTVSPALAQLLASIAASDATHATVLANKGLTSKGLGG* |
| Ga0164298_111927252 | 3300012955 | Soil | LRAAERASAADLVQRLATVPPALAQLFASIAASDATHVAVLGG* |
| Ga0164301_104550661 | 3300012960 | Soil | AADLVRRLATAPPALAQLLASIAASDATHATALGG* |
| Ga0164305_121139912 | 3300012989 | Soil | LRAAERASAADLVQRLGTVPPALAQLFASIAASDATHVAVLGG* |
| Ga0157372_113332513 | 3300013307 | Corn Rhizosphere | GSSPRVSTVTTSRLRSAERASAADLVRRLATVPPALAQLLASIAASDATHVTVLGG* |
| Ga0181531_106857611 | 3300014169 | Bog | ERASAAGLVRRLATVEPALAQLFASIAASDATHVTALGG* |
| Ga0187809_101955223 | 3300017937 | Freshwater Sediment | LRTAERESATSLVRQLGAAEPALAQLFASIAACHATHVAALSG |
| Ga0187808_100366936 | 3300017942 | Freshwater Sediment | LRAAEHASATGLLTRLVTVEPSLAQLFASIAASDATHVVALGGWG |
| Ga0187819_102524221 | 3300017943 | Freshwater Sediment | ERAPVADLLRRLVTVQPALAQLFASIAASDATHAVALSG |
| Ga0187819_104590802 | 3300017943 | Freshwater Sediment | ERASAADLLRRLVTVQPALAQLFASIAASDATHVVALGG |
| Ga0187890_107568261 | 3300018044 | Peatland | EHASATRLVQRLATVEPALAQLFASIAASDATHVTALGG |
| Ga0187765_110463841 | 3300018060 | Tropical Peatland | ASATDLVGRLVSMPPALAQLFASIAASDATHVVALGG |
| Ga0187784_104951343 | 3300018062 | Tropical Peatland | RLRAAERASAAGLVQRLGPVEPALAQLFASIAASDVTHVMALGG |
| Ga0210407_104938913 | 3300020579 | Soil | QRLTTVQPALAQLFASIAASDATHVTVLAEAGLGG |
| Ga0210407_107021363 | 3300020579 | Soil | ERASAANLVRRLATAPPALAQLLASIAASDATHVTALGG |
| Ga0210399_109696511 | 3300020581 | Soil | AGLVQRLTTVQPALAQLFASIAASDATHVTVLAEAGLGG |
| Ga0210404_101082563 | 3300021088 | Soil | LRAAERASATDLVRRLVSVPPALAQLFASIAASDATHVAALGG |
| Ga0210396_107393763 | 3300021180 | Soil | ASATDLVQRLVSVPPALAQLFASIAASDATHVAALAGYGQG |
| Ga0210388_105806741 | 3300021181 | Soil | ERASAVGLVRRLATVEPALAQLFASIAASDATHVAALGG |
| Ga0210387_111267091 | 3300021405 | Soil | ASATGLVQRLTTVEPALAQLFASIAASDATHVTVLAEAGLGG |
| Ga0210392_112642622 | 3300021475 | Soil | ERASAADLVQRLATAPPALAQLLASIAASDATHATALGG |
| Ga0210392_114158642 | 3300021475 | Soil | RTTIAQLRTAEGASATDLVQRLVSEPPALAQLFASIAASDATHVAALAGYGQG |
| Ga0210402_104872502 | 3300021478 | Soil | GLRAAERASAADLVQRLVTVPPALAQLFASIAASDATHVTALGG |
| Ga0210402_111978253 | 3300021478 | Soil | AADLVRRLATAPPALAQLLASIAASDATHATALGG |
| Ga0210409_103613621 | 3300021559 | Soil | LRAAERASAADLVQRLATAPPALAQLLASIAASDATHVTVLGG |
| Ga0210409_105819853 | 3300021559 | Soil | AQLRTAEGASATDLVQRLVSVPPALAQLFASIAASDATHVAALAGYGQG |
| Ga0247691_10226961 | 3300024222 | Soil | ERASAADLVRRLATAPPALAQLLASIAASDATHATALGG |
| Ga0247681_10030891 | 3300024310 | Soil | ASAADLVRRLATAPPALAQLLASIAASDATHATALGG |
| Ga0207700_119334261 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ASAADLVQRLGTVPPALAQLFASIAASDATHVAVLGG |
| Ga0257150_10249603 | 3300026356 | Soil | ASATDLVRRLVSVPPALAQLFASIAASDATHVVALGGNGQGS |
| Ga0257158_10036371 | 3300026515 | Soil | LVRRLVSVPPALAQLFASIAASDATHVVALGGNGQGS |
| Ga0209221_10079561 | 3300027609 | Forest Soil | LRAAEQRSASSLVRRLSTVSVEPALAQLLASIAASDASHDAELGAL |
| Ga0209420_11602852 | 3300027648 | Forest Soil | AGVRRLGTVEPALAQLFASIAACDATHVAALAALA |
| Ga0208565_11296263 | 3300027662 | Peatlands Soil | ADLVQRLATVEPALAQLFASIAASDATHVTVLAEKGLG |
| Ga0209656_100367333 | 3300027812 | Bog Forest Soil | VQRLATVEPALAQLFASIAASDATHVTVLAEKGLG |
| Ga0209773_101995283 | 3300027829 | Bog Forest Soil | LVQRLATVEPALAQLFASIAASDATHATALAAKGLG |
| Ga0209167_101474953 | 3300027867 | Surface Soil | SADLVRRLGGAEPALAQLFASIAACHATHVAALGG |
| Ga0209167_103426821 | 3300027867 | Surface Soil | VTVEVLRGAEGASATDLVRRLVNVPPALAQLFASIAASDATHVTALGG |
| Ga0209590_106929961 | 3300027882 | Vadose Zone Soil | RASAAGLVQRLATVPPALAQLLASIAASDATHVTVLGG |
| Ga0209624_109008302 | 3300027895 | Forest Soil | VSIAQLRAAEGASAASLLRRLATVQPALAQLFASIAASDATHAMVLGG |
| Ga0209067_102568953 | 3300027898 | Watersheds | QLRAAERASAAGLVQRLASVEPALAQLFASIAASDATHVTVLTDNGLAEG |
| Ga0302225_102439673 | 3300028780 | Palsa | AERASAAGLVRRLATVEPALAQLFASIAASDATHVAALGG |
| Ga0302225_103726221 | 3300028780 | Palsa | SAASLVRRLATVEPALAQLFASIAASDATHVAALGG |
| Ga0302229_105313272 | 3300028879 | Palsa | ERASAASLVRRLATVEPALAQLFASIAASDATHVTALGG |
| Ga0308309_101073041 | 3300028906 | Soil | AAERASAADLVQRLATVEPALAQLFASIAASDATHATVLAEKGLG |
| Ga0311340_101677711 | 3300029943 | Palsa | AAERASATNLVRRLVTVPPDLAQLFASIAASDATHAVALGG |
| Ga0311352_1000821914 | 3300029944 | Palsa | AVGLVRRLATVEPALAQLFASIAASDATHVTALGG |
| Ga0311339_102157033 | 3300029999 | Palsa | TAVARHVTIARLQAAERTSATDLVRRLSTAAPALAQLFASIAASDATHLVALGG |
| Ga0311356_102938773 | 3300030617 | Palsa | SAAGLVRRLATTEPALAQLLASIAASDATHVAVLGG |
| Ga0318573_105785281 | 3300031564 | Soil | VSTVRLREAERASAAGLVQRLATVEPALAQLFASIAASDATHATALGG |
| Ga0318542_103126962 | 3300031668 | Soil | AEQASAADLLRRLVTVQPALAQLFASIAASDATHLAALGG |
| Ga0318496_105571362 | 3300031713 | Soil | LRAAEHASAADLVQRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0307474_115169261 | 3300031718 | Hardwood Forest Soil | VPPGLVQLRAAERESSVDLVRRLGGAEPALAQLFASIAACHATHVAALGG |
| Ga0318502_107103282 | 3300031747 | Soil | ASTADLLRRLVTVQPALAQLFASIAASDATHVAALGG |
| Ga0318502_109776981 | 3300031747 | Soil | VSTERLRAAERASAADLVRRLVTMPPALAQLFASIAASDATHVTVLGG |
| Ga0318535_103985251 | 3300031764 | Soil | ERLRAAERASAADLVRRLVTMPPALAQLFASIAASDATHVTVLGG |
| Ga0318554_102021271 | 3300031765 | Soil | GLVRRLATVQPALAQLFASIAASDATHATVLARIGG |
| Ga0318554_105461272 | 3300031765 | Soil | AAGLLRRLVTVQPALAQLFASIAASDATHAVALGG |
| Ga0318521_106575941 | 3300031770 | Soil | ERASAADLVRRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0318552_106014941 | 3300031782 | Soil | ASAAGLVQRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0318557_101696593 | 3300031795 | Soil | RASAAGLVQRLGTAEPALAQLFASIAASDATHVTALGG |
| Ga0318497_100720624 | 3300031805 | Soil | ARAAERASAADLVRRLVTMPPALAQLFASIAASDATHVTVLGG |
| Ga0318568_106233751 | 3300031819 | Soil | SRLRAAEHASAADLVQRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0318568_110427032 | 3300031819 | Soil | AERGSAADLLRRLAGVPPALAQLFASIAASDATHQAALGG |
| Ga0318512_105774341 | 3300031846 | Soil | AEHASAAGLVQRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0318512_106902451 | 3300031846 | Soil | AVTVSRLRAAEHASAAGLVQRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0318551_107239382 | 3300031896 | Soil | RLRAAERASVADLIRRLVTVQPALAQLFASIAASDATHVAALSG |
| Ga0310912_114982971 | 3300031941 | Soil | AEHASAADLVQRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0310913_113034671 | 3300031945 | Soil | RAAERASAADLLRRLVTVQPALAQLLASIAASDATHVAALGG |
| Ga0306922_108555423 | 3300032001 | Soil | AAERASAADLVRRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0318556_103874612 | 3300032043 | Soil | SAAGLVQRLGTAEPALAQLFASIAASDATHVTALGG |
| Ga0318558_104831262 | 3300032044 | Soil | PRAVTVSRLRAAEHASAADLVQRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0318504_102667581 | 3300032063 | Soil | TVTSLRSRSAAEQASAADLLRRLVTVQPALAQLFASIAASDATHLAALGG |
| Ga0318504_104441271 | 3300032063 | Soil | STGPVRVSTARLREAERASAAGLVQRLATVEPALAQLFASIAASDATHATALGG |
| Ga0318513_104394272 | 3300032065 | Soil | GASAADLVQRLATVPPALAQLFASIAASDATHVTALGG |
| Ga0306920_1026704951 | 3300032261 | Soil | ASPGPVRVSTVRLREAERASAAGLVQRLATVEPALAQLFASIAASDATHATALGG |
| Ga0335085_113683753 | 3300032770 | Soil | ASAADLVQQLAAMPPALAQLFASIAASDATHATALGG |
| Ga0335074_111421162 | 3300032895 | Soil | RASAADLVRQLVTVPPALAQLFASIAASDATHVVALGG |
| Ga0335071_113983091 | 3300032897 | Soil | EHASAADLVQRLATAPPALAQLFASIAASDATHVTALGG |
| Ga0335073_110418831 | 3300033134 | Soil | AERASAEDLVQRLATVPPALAQLFASIAASDATHVTALGG |
| ⦗Top⦘ |