| Basic Information | |
|---|---|
| Family ID | F102153 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSDSEDLELQALQRQLDDAFETTRPRVGFEDELWTRMQARRP |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.12 % |
| % of genes from short scaffolds (< 2000 bps) | 83.33 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.059 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.706 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF08281 | Sigma70_r4_2 | 71.57 |
| PF03009 | GDPD | 19.61 |
| PF04545 | Sigma70_r4 | 6.86 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 19.61 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.06 % |
| Unclassified | root | N/A | 2.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090004|P1_DRAFT_NODE_299531_len_796_cov_10_604271 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 2140918006|ConsensusfromContig100242 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10026145 | All Organisms → cellular organisms → Bacteria | 1588 | Open in IMG/M |
| 3300000887|AL16A1W_10435517 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300001334|A2165W6_1071283 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
| 3300001361|A30PFW6_1069550 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300001397|JGI20177J14857_1037700 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300001535|A3PFW1_10069177 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
| 3300001536|A1565W1_11780943 | All Organisms → cellular organisms → Bacteria | 2617 | Open in IMG/M |
| 3300001537|A2065W1_10208341 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300001593|JGI12635J15846_10383053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 853 | Open in IMG/M |
| 3300001661|JGI12053J15887_10204477 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300002917|JGI25616J43925_10371718 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005171|Ga0066677_10702065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 566 | Open in IMG/M |
| 3300005174|Ga0066680_10012117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4473 | Open in IMG/M |
| 3300005406|Ga0070703_10518871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
| 3300005451|Ga0066681_10041057 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
| 3300005471|Ga0070698_100993117 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300005471|Ga0070698_101548994 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005537|Ga0070730_10917291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
| 3300005545|Ga0070695_101081503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
| 3300005554|Ga0066661_10561540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
| 3300005555|Ga0066692_10925991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300005557|Ga0066704_10040608 | All Organisms → cellular organisms → Bacteria | 2895 | Open in IMG/M |
| 3300005560|Ga0066670_10572710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 689 | Open in IMG/M |
| 3300005569|Ga0066705_10358237 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300005587|Ga0066654_10033677 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300005598|Ga0066706_10939035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300005947|Ga0066794_10051537 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300006032|Ga0066696_10503119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 795 | Open in IMG/M |
| 3300006041|Ga0075023_100448355 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300006046|Ga0066652_100666408 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300006058|Ga0075432_10173596 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300006162|Ga0075030_100506429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 960 | Open in IMG/M |
| 3300006800|Ga0066660_11591515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
| 3300007258|Ga0099793_10213441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 927 | Open in IMG/M |
| 3300007265|Ga0099794_10143757 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300009088|Ga0099830_10888913 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009143|Ga0099792_10892654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 588 | Open in IMG/M |
| 3300010321|Ga0134067_10284428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
| 3300010337|Ga0134062_10697666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
| 3300010337|Ga0134062_10702605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300012096|Ga0137389_10443725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1111 | Open in IMG/M |
| 3300012096|Ga0137389_11802739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 508 | Open in IMG/M |
| 3300012200|Ga0137382_10088460 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
| 3300012201|Ga0137365_10061914 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
| 3300012206|Ga0137380_10163457 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300012207|Ga0137381_10430693 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300012208|Ga0137376_10064971 | All Organisms → cellular organisms → Bacteria | 3021 | Open in IMG/M |
| 3300012208|Ga0137376_10995738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 718 | Open in IMG/M |
| 3300012211|Ga0137377_10928690 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300012350|Ga0137372_10150424 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
| 3300012363|Ga0137390_10613323 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300012922|Ga0137394_10301516 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300012927|Ga0137416_10299773 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300012927|Ga0137416_10504496 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300012944|Ga0137410_10090514 | All Organisms → cellular organisms → Bacteria | 2252 | Open in IMG/M |
| 3300013763|Ga0120179_1007345 | All Organisms → cellular organisms → Bacteria | 2982 | Open in IMG/M |
| 3300014150|Ga0134081_10194416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 686 | Open in IMG/M |
| 3300014157|Ga0134078_10151575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 912 | Open in IMG/M |
| 3300015357|Ga0134072_10432526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
| 3300017659|Ga0134083_10080412 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300020581|Ga0210399_10809510 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300020581|Ga0210399_10902444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
| 3300021046|Ga0215015_10227986 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300021178|Ga0210408_10528643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 937 | Open in IMG/M |
| 3300021432|Ga0210384_10318800 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300021432|Ga0210384_10691879 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300021439|Ga0213879_10251117 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300022691|Ga0248483_109045 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025862|Ga0209483_1238295 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300025928|Ga0207700_11726352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
| 3300026309|Ga0209055_1219217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
| 3300026312|Ga0209153_1016723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2381 | Open in IMG/M |
| 3300026317|Ga0209154_1280416 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300026323|Ga0209472_1140721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 920 | Open in IMG/M |
| 3300026325|Ga0209152_10076579 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300026325|Ga0209152_10198310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 754 | Open in IMG/M |
| 3300026358|Ga0257166_1006742 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300026499|Ga0257181_1035990 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300026499|Ga0257181_1042377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 742 | Open in IMG/M |
| 3300026524|Ga0209690_1287365 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026547|Ga0209156_10285869 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300026550|Ga0209474_10154476 | All Organisms → cellular organisms → Bacteria | 1492 | Open in IMG/M |
| 3300026552|Ga0209577_10116595 | All Organisms → cellular organisms → Bacteria | 2144 | Open in IMG/M |
| 3300027587|Ga0209220_1030611 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300027587|Ga0209220_1154181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
| 3300027603|Ga0209331_1070894 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300027633|Ga0208988_1072630 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300027669|Ga0208981_1095863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 757 | Open in IMG/M |
| 3300027674|Ga0209118_1116637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 747 | Open in IMG/M |
| 3300027842|Ga0209580_10169674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1077 | Open in IMG/M |
| 3300027862|Ga0209701_10131842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1539 | Open in IMG/M |
| 3300031747|Ga0318502_10899290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 538 | Open in IMG/M |
| 3300031754|Ga0307475_10230650 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300031880|Ga0318544_10196765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 778 | Open in IMG/M |
| 3300031962|Ga0307479_10767202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 941 | Open in IMG/M |
| 3300032180|Ga0307471_103492482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
| 3300032205|Ga0307472_102720353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.78% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.86% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 6.86% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001397 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300022691 | Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P1_DRAFT_00819190 | 2088090004 | Soil | MIEDEDLELLALQRRLDDAFQTTRPRRDFEDELWLRMQS |
| P1_C_00339370 | 2140918006 | Soil | VSEPEDLELEALQRQLDDAFETTRPRAGFEDELWTRMQARRP |
| AF_2010_repII_A1DRAFT_100261454 | 3300000597 | Forest Soil | MSDENEDVELQALQRQLDDAFATTRPRRGYEDELWVRVQQSR |
| AL16A1W_104355172 | 3300000887 | Permafrost | MSEDEDLELQALQRLLDDAFQATRPRPAFEDELWLRMQSRRPI |
| A2165W6_10712831 | 3300001334 | Permafrost | MSEEEDLELKALQRQLDDAFQTTRPRPAFEDELWLRMQSR |
| A30PFW6_10695502 | 3300001361 | Permafrost | MSEEEDLELKALQRQLDDAFQTTRPRPAFEDELWLRMQSRRP |
| JGI20177J14857_10377002 | 3300001397 | Arctic Peat Soil | MSEDEDLELQALQRQLDDAFQTTRPRADFEDELWLRMQSRRPI |
| A3PFW1_100691774 | 3300001535 | Permafrost | VSEPEDLELEALQRQLDDAFDTTRPRAGFEDELWTRMQA |
| A1565W1_117809431 | 3300001536 | Permafrost | MSEHEDDLELAALQRQLDDAFETTRPRAGFEDELWSRMQARRP |
| A2065W1_102083412 | 3300001537 | Permafrost | MSDEEELNLQALQRQLDDAFQTTRPRPAFEDELWLRMQA |
| JGI12635J15846_103830531 | 3300001593 | Forest Soil | MSEDEDLDLLALQRQLDDAFQTTRPRPAFEDELWLRLQSRRPFWQRF |
| JGI12053J15887_102044773 | 3300001661 | Forest Soil | VSEPEDLELEALQRQLDDAFDTTRPRVGFEDELWTRMQASR |
| JGI25390J43892_101130622 | 3300002911 | Grasslands Soil | VSEQEEELEVQALQRQLDDAFETTRPRPGFDDELWLRMQGSRPAGSRLGDA |
| JGI25616J43925_103717181 | 3300002917 | Grasslands Soil | VSEQEEELELQAMQRELDDAFATTRPRAGYEDELWLRMQAQRPAPNKI |
| Ga0066677_107020651 | 3300005171 | Soil | MSEPEEDLELQALQRQLDDAFETTRPRRGFEDELWVRMQASRPATNRLR |
| Ga0066680_100121171 | 3300005174 | Soil | MNEDEDLELQALQRRLDDAFQTTRPRAGFEDELWSRMQARRPVWL |
| Ga0070703_105188712 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERDEDDLELQALQRELDDAFATTRPRRGYEDELWLLIQ |
| Ga0066681_100410571 | 3300005451 | Soil | VSEQDDELELQALQRELDDAFATTRPRAGFDDELWLRMQSKRPL |
| Ga0066687_106674602 | 3300005454 | Soil | MSDSDDELDLQALQRKLDDAFETTRPRPGFDDELWLRMQSSRPVTSRLRDALAGFV |
| Ga0070698_1009931172 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VKGDEDLELQALQRQLDDAFETTRPRAGFEDALWSRMQAR |
| Ga0070698_1015489942 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VNDDEDLELQALQRQLDDAFETTRPRAGFEDALWSRMQARRPLWRR |
| Ga0070730_109172911 | 3300005537 | Surface Soil | VSENGEDLDLQALERKLDEAFATTRPRAGFEDELWLR |
| Ga0070695_1010815032 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEPDDDLELQALQRELDDAFATTRPRAGFDDELWLRMQA |
| Ga0066661_105615402 | 3300005554 | Soil | VSEQDEDLELQALQRELDDAFATTRPRVGFDDELWLRMQAKRPFSTRV |
| Ga0066692_109259911 | 3300005555 | Soil | VSEQEEELEVQALQRQLDDAFETTRPRPGFDDELWL |
| Ga0066704_100406084 | 3300005557 | Soil | VSEQEEELEVQALQRQLDDAFETTRPRPGFDDELWLRMQSSR |
| Ga0066670_105727102 | 3300005560 | Soil | VNENDEDLELAALQRRLDDAFETTRPRPGFDDELWLRMQSSRPASSR |
| Ga0066705_103582373 | 3300005569 | Soil | VNENDEDIELAALQRRLDDAFETTRPRPGFDDELWLRMQSSRPASSRLRD |
| Ga0066654_100336774 | 3300005587 | Soil | LSDDKDDLELAALQRQLDDAFETTRPRRGYEDELWLKLQARRP |
| Ga0066706_109390351 | 3300005598 | Soil | VSKQDDELELQALQRELDDAFATTRPRVGFDDELWLRMQARRPLST |
| Ga0066794_100515371 | 3300005947 | Soil | MSEEEDLDLLALQRQLDDAFQTTRPRPAFEDELWLRMQSRRPIWS |
| Ga0066696_105031193 | 3300006032 | Soil | VSKQDDELELQALQRELDDAFATTRPRVGFDDELW |
| Ga0075023_1004483552 | 3300006041 | Watersheds | MSERDNELEALQRQLDDAFMTTRPRRGFEDELWQRMQER |
| Ga0066652_1006664081 | 3300006046 | Soil | MSEHDEDLELQALQRQLDDAFQTTRPRRGFEDDLWLRMQASRPAT |
| Ga0075432_101735963 | 3300006058 | Populus Rhizosphere | MSDRDDDLELQALQRELDDAFATTRPRRDFEDELWVRMQ |
| Ga0075030_1005064291 | 3300006162 | Watersheds | MSEQDDDLELQALQRQLDDAFESTRPRRGFEDQLWLRMQERRPLWSRI |
| Ga0066660_115915151 | 3300006800 | Soil | MNENDEDLELAALQRQLDDAFETTRPRPGFDDELWLRVQSSRA |
| Ga0099793_102134411 | 3300007258 | Vadose Zone Soil | VSEQEEDLELQALQRQLDDAFETTRPRLGFDDELWLRMQSSRPARSRLRD |
| Ga0099794_101437573 | 3300007265 | Vadose Zone Soil | MSDDEDRELQALQRQLDDAFETTRPRAGFEEDLWSRMQARRPIWVRAL |
| Ga0099830_108889131 | 3300009088 | Vadose Zone Soil | VSDSEDLELQALQRQLDDAFETTRPRPGFEDELWTRIQ |
| Ga0099792_108926541 | 3300009143 | Vadose Zone Soil | MSDDEDRELQALQRQLDDAFETTRPRAGFEDDLWSKMQARRP |
| Ga0134067_102844281 | 3300010321 | Grasslands Soil | VSKQDDELELQALQRELDDAFATTRPRVGFDDELWLRM |
| Ga0134062_106976662 | 3300010337 | Grasslands Soil | VSEKDEDLELQALQRELDDAFATTRPRVGFDDALW |
| Ga0134062_107026052 | 3300010337 | Grasslands Soil | MSELDDDLEVQALQRELDDAFATTRPRRGYEDELWLLIQQQRPV |
| Ga0137389_104437251 | 3300012096 | Vadose Zone Soil | VSEQEEDLELQALQRQLDDAFETTRPRSGFDDELWLRM |
| Ga0137389_118027392 | 3300012096 | Vadose Zone Soil | MSDDEDLELQALQRKLDDAFETTRPRAGFEDALWSRMQ |
| Ga0137382_100884601 | 3300012200 | Vadose Zone Soil | VSEQDDELELQALQRELDDAFATTRPRAGFDDELWLRMQT |
| Ga0137365_100619141 | 3300012201 | Vadose Zone Soil | LSDNKDDLELQALQRELDDAFATTRPRRDFEDELWLRMQARRPLWTR |
| Ga0137380_101634571 | 3300012206 | Vadose Zone Soil | LSDDKEDLELQALQRELDDAFATTRPRRGYEDELWLRMQAR |
| Ga0137381_104306931 | 3300012207 | Vadose Zone Soil | LNDDEELELAALQRKLDDAFQTTRPRANFEDELWLRM |
| Ga0137376_100649711 | 3300012208 | Vadose Zone Soil | MSEDEDLDLQALQRQLDDAFQTTRPRPAFEDELWLRMQTRRPIWLRLREG |
| Ga0137376_109957382 | 3300012208 | Vadose Zone Soil | MSEPDDELELQALQRQLDDAFETTRPRTGFDDELWLRMQSSRPARSRLRD |
| Ga0137377_109286901 | 3300012211 | Vadose Zone Soil | MNDDEDLELQALQRQLDDAFQTTRPRAGFGDHLWAELQVRRPLLQR |
| Ga0137372_101504244 | 3300012350 | Vadose Zone Soil | VSEPPEEIDDLELQALQRELDGAFESTRPRPGFEDELWLQVQSA |
| Ga0137390_106133233 | 3300012363 | Vadose Zone Soil | MNEDEDLELQALQRRLDDAFQTTRPRAAFEDELWSKM |
| Ga0137397_111666731 | 3300012685 | Vadose Zone Soil | VSDPDEELELQALQRQLDDAFETTRPRTEFDDELWLRMQSSRPARSRLRDAISGLFQ |
| Ga0137394_103015163 | 3300012922 | Vadose Zone Soil | MSDSEDLELQALQRQLDDAFETTRPRPGFEDELWTRIQA |
| Ga0137416_102997733 | 3300012927 | Vadose Zone Soil | VSEQEEDLELQALQRQLDDAFETTRPRPGFDDELWLRMQSSRPARSR |
| Ga0137416_105044961 | 3300012927 | Vadose Zone Soil | MSNSEDLEFQAIQRQLDDAFETTRPRAGFEDELWTRIQARRP |
| Ga0137410_100905144 | 3300012944 | Vadose Zone Soil | VSEDEDLELQALQRQLDDAFQTTRPRPSFEDELWLRMQARRPIWTRFREGL |
| Ga0120179_10073454 | 3300013763 | Permafrost | MSEHEDDLELAALQRQLDDAFETTRPRAGFEDELWA |
| Ga0134081_101944162 | 3300014150 | Grasslands Soil | MSEPDGDLELQGLQRELDDAFQTTRPRPAFEDELWLKMQTSRPPARR* |
| Ga0134078_101515753 | 3300014157 | Grasslands Soil | LSDDKEDLELAALQRELDDAFATTRPRRGFEDDLWL |
| Ga0134072_104325261 | 3300015357 | Grasslands Soil | VSEQEEELEVQALQRQLDDAFETTRPRPGFDDELWLRMQSSRPAKS |
| Ga0134083_100804123 | 3300017659 | Grasslands Soil | MSERDDDLELQALQRELDDAFATTRPRRDFEDELWLRMQAARPA |
| Ga0210399_108095101 | 3300020581 | Soil | VNEEEDLELLALQRQLDDAFQTTRPRANFEDELWSRMQSRRPIWPRLR |
| Ga0210399_109024441 | 3300020581 | Soil | VSEEPEDLELAALQRQLDDAFETTRPRAGFEDELWTRM |
| Ga0215015_102279862 | 3300021046 | Soil | MSDDENLDLQALQRQLDDAFETTRPRAAFELSLIHI |
| Ga0210408_105286433 | 3300021178 | Soil | MSENDEDLELAAMQRQLDDAFATTRPRQGFEDELWLRVQSSRPAP |
| Ga0210384_103188001 | 3300021432 | Soil | MSDNEDRELQALQRQLDDAFQTTRPRAAFEDDLWSRMQERRPVWQRVRDF |
| Ga0210384_106918793 | 3300021432 | Soil | VSEPEEELELQALQRKLDDAFETTRPRPGFDDELW |
| Ga0213879_102511171 | 3300021439 | Bulk Soil | LSKDPEELELEALQRRLDDAFETTRPRRGFEDELWLRMQRKRPFG |
| Ga0248483_1090451 | 3300022691 | Soil | MNDDEDLELQALQRRLDDAFQTTRPRAGFEDELWSRMQARRPV |
| Ga0209483_12382952 | 3300025862 | Arctic Peat Soil | MSEEEDLELQALQRQLDDAFQTTRPRADFEDELWLRMQSRRPIWLR |
| Ga0207700_117263521 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSEPDDLELEALQRQLDDAFETTRPRAGFEDELWTRMQARR |
| Ga0209055_12192171 | 3300026309 | Soil | MSDPDEELELQALQRQLDDAFETTRPRTGFEDELWLRMQSSRAAPSRLRD |
| Ga0209153_10167234 | 3300026312 | Soil | MSEPEEDLELQALQRQLDDAFETTRPRRGFEDELWVRMQASRPATNR |
| Ga0209154_12804162 | 3300026317 | Soil | MSDEEDLELQALQRQLDDAFQTTRPRAGFEDHLWAELQV |
| Ga0209472_11407211 | 3300026323 | Soil | VSEQEEELEVQALQRQLDDAFETTRPRPGFDDELWLRMQSSRPAKSR |
| Ga0209152_100765791 | 3300026325 | Soil | VSEQEEELEVQALQRQLDDAFETTRPRPGFDDELWLRMQ |
| Ga0209152_101983101 | 3300026325 | Soil | LSEPEEELELQALQRQLDDAMETTRPRPDFEDELWL |
| Ga0257166_10067421 | 3300026358 | Soil | MNEDEDLELQALQRRLDDAFQTTRPRAAFEDELWSKMQ |
| Ga0257181_10359901 | 3300026499 | Soil | MNEDEDLELQALQRRLDDAFQTTRPRAGFEDELWSRMQARR |
| Ga0257181_10423771 | 3300026499 | Soil | VSEPDDDLELEALKRQLDDAFQTTRPRPDFEDELWTRMQARRPAGT |
| Ga0209690_12873651 | 3300026524 | Soil | MNEDEDLELQALQRRLDDAFQTTRPRAGFEDELWSRMQARRPVWPQV |
| Ga0209156_102858691 | 3300026547 | Soil | LSDDKDDLELAALQRQLDDAFETTRPRRGYEDELWLQLQARRP |
| Ga0209474_101544763 | 3300026550 | Soil | VNENDEDLELAALQRQLDDAFETTRPRPGFDDELWLRMQSSRP |
| Ga0209577_101165954 | 3300026552 | Soil | MSDKEEDLELQALQRQLDDAFETTRPRTGFEDELWLR |
| Ga0209220_10306113 | 3300027587 | Forest Soil | VSDEPEDLEVAALQRQLDDAFETTRPRAGFEDELWTR |
| Ga0209220_11541811 | 3300027587 | Forest Soil | MSDQEDELELAALQRQLDDAFETTRPRIGFEDELWTRMQAR |
| Ga0209331_10708941 | 3300027603 | Forest Soil | VSDSEDLELEALQRQLDDAFETTRPRRGFEDELWTRMQ |
| Ga0208988_10726301 | 3300027633 | Forest Soil | MSDSEDLELQALQRQLDDAFETTRPRVGFEDELWTRMQARRP |
| Ga0208981_10958632 | 3300027669 | Forest Soil | VSEPEDLELEALQRQLDDAFDTTRPRAGFEDELWTRMQARRP |
| Ga0209118_11166372 | 3300027674 | Forest Soil | MSDEEDIDLLALQRQLDDAFETTRPRRGFDDELWLRLQSRRPIWRRC |
| Ga0209580_101696743 | 3300027842 | Surface Soil | VSQDNEELELQALERQLEDAFQTTRPRPDFEDELWLRLQS |
| Ga0209701_101318421 | 3300027862 | Vadose Zone Soil | VNEPEDLELEALKRQLDDAFQTTRPRPDFEDELWTRMQAR |
| Ga0318502_108992901 | 3300031747 | Soil | MSDHEDELELQALERQLDDAFETTRPRPAFSDELW |
| Ga0307475_102306501 | 3300031754 | Hardwood Forest Soil | MDDLELAALQRQLDDAFETTRPRRGYEDELWLKLQAR |
| Ga0318544_101967653 | 3300031880 | Soil | MSQNGEELELQALERQLDDAFETTRPRAGFEDELWLRMKSS |
| Ga0307479_107672023 | 3300031962 | Hardwood Forest Soil | MNDDGDELELAALQRQLDDAFETTRPRAGFDDELWL |
| Ga0307471_1034924821 | 3300032180 | Hardwood Forest Soil | MSDDGDELELAALQRQLDDAFETTRPRSGFDDELWLRVQGS |
| Ga0307472_1027203531 | 3300032205 | Hardwood Forest Soil | MSERDDDDLELQALQRQLDDAFATTRPRRGYEDEV |
| ⦗Top⦘ |