| Basic Information | |
|---|---|
| Family ID | F102152 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | AEELGDRQLPAWTWRNLAKVAELRGDKAAAEELLRRSQDAESRGPH |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.20 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.529 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.235 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.922 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.89% β-sheet: 0.00% Coil/Unstructured: 58.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF04264 | YceI | 20.59 |
| PF00583 | Acetyltransf_1 | 9.80 |
| PF02518 | HATPase_c | 9.80 |
| PF08281 | Sigma70_r4_2 | 8.82 |
| PF13489 | Methyltransf_23 | 2.94 |
| PF00027 | cNMP_binding | 1.96 |
| PF04237 | YjbR | 1.96 |
| PF07690 | MFS_1 | 1.96 |
| PF01209 | Ubie_methyltran | 1.96 |
| PF12680 | SnoaL_2 | 1.96 |
| PF00775 | Dioxygenase_C | 1.96 |
| PF00106 | adh_short | 1.96 |
| PF12698 | ABC2_membrane_3 | 0.98 |
| PF10604 | Polyketide_cyc2 | 0.98 |
| PF04185 | Phosphoesterase | 0.98 |
| PF00202 | Aminotran_3 | 0.98 |
| PF02687 | FtsX | 0.98 |
| PF00437 | T2SSE | 0.98 |
| PF02896 | PEP-utilizers_C | 0.98 |
| PF01022 | HTH_5 | 0.98 |
| PF00990 | GGDEF | 0.98 |
| PF07905 | PucR | 0.98 |
| PF02566 | OsmC | 0.98 |
| PF05050 | Methyltransf_21 | 0.98 |
| PF12832 | MFS_1_like | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 20.59 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.96 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 1.96 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 1.96 |
| COG2508 | DNA-binding transcriptional regulator, PucR/PutR family | Transcription [K] | 1.96 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.96 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.98 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.98 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573000|GPBTN7E02GZWYJ | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 511 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_14357906 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300001154|JGI12636J13339_1003160 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
| 3300001361|A30PFW6_1080845 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300001593|JGI12635J15846_10003167 | All Organisms → cellular organisms → Bacteria | 14358 | Open in IMG/M |
| 3300002912|JGI25386J43895_10052182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1170 | Open in IMG/M |
| 3300002916|JGI25389J43894_1056980 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005167|Ga0066672_10604755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 710 | Open in IMG/M |
| 3300005175|Ga0066673_10168360 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300005181|Ga0066678_10284809 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300005184|Ga0066671_10162794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1312 | Open in IMG/M |
| 3300005187|Ga0066675_10396990 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300005332|Ga0066388_100393781 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
| 3300005444|Ga0070694_100977357 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005445|Ga0070708_100779584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 899 | Open in IMG/M |
| 3300005450|Ga0066682_10165043 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300005454|Ga0066687_10580105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
| 3300005467|Ga0070706_100708397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
| 3300005518|Ga0070699_100971771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 778 | Open in IMG/M |
| 3300005518|Ga0070699_101959785 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005535|Ga0070684_101303264 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005540|Ga0066697_10344521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 869 | Open in IMG/M |
| 3300005545|Ga0070695_101662392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300005552|Ga0066701_10931354 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005553|Ga0066695_10558560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 694 | Open in IMG/M |
| 3300005558|Ga0066698_10286896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1140 | Open in IMG/M |
| 3300005559|Ga0066700_11134417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| 3300005566|Ga0066693_10102968 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300005568|Ga0066703_10132967 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300005586|Ga0066691_10736757 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300005598|Ga0066706_10665819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 826 | Open in IMG/M |
| 3300005764|Ga0066903_102720232 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300005981|Ga0081538_10066480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2021 | Open in IMG/M |
| 3300006804|Ga0079221_10327594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 913 | Open in IMG/M |
| 3300006804|Ga0079221_10815596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
| 3300006852|Ga0075433_10727882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 868 | Open in IMG/M |
| 3300006852|Ga0075433_11763115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
| 3300006854|Ga0075425_102297091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
| 3300006893|Ga0073928_10465166 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300006893|Ga0073928_10892165 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300006903|Ga0075426_10989818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 635 | Open in IMG/M |
| 3300007076|Ga0075435_101666924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 559 | Open in IMG/M |
| 3300007265|Ga0099794_10352273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 766 | Open in IMG/M |
| 3300007788|Ga0099795_10629123 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300009012|Ga0066710_103384346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
| 3300009088|Ga0099830_10917529 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300009089|Ga0099828_11590476 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300009090|Ga0099827_10234143 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300009137|Ga0066709_103899318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300009137|Ga0066709_104429972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
| 3300009143|Ga0099792_10931329 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010047|Ga0126382_12507068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
| 3300010323|Ga0134086_10336256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 594 | Open in IMG/M |
| 3300010326|Ga0134065_10093036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 991 | Open in IMG/M |
| 3300010326|Ga0134065_10334491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
| 3300010335|Ga0134063_10216879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 904 | Open in IMG/M |
| 3300010336|Ga0134071_10223753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 932 | Open in IMG/M |
| 3300010399|Ga0134127_10150846 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300011269|Ga0137392_10308069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
| 3300011270|Ga0137391_10055724 | All Organisms → cellular organisms → Bacteria | 3375 | Open in IMG/M |
| 3300011270|Ga0137391_11146044 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300011271|Ga0137393_11270476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
| 3300011271|Ga0137393_11482346 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012189|Ga0137388_11295808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
| 3300012201|Ga0137365_10135238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1853 | Open in IMG/M |
| 3300012202|Ga0137363_10598645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 930 | Open in IMG/M |
| 3300012203|Ga0137399_10791244 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300012204|Ga0137374_10362678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → unclassified Ilumatobacter → Ilumatobacter sp. | 1164 | Open in IMG/M |
| 3300012208|Ga0137376_10916649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 752 | Open in IMG/M |
| 3300012210|Ga0137378_10979041 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012211|Ga0137377_11612091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
| 3300012350|Ga0137372_11183660 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012917|Ga0137395_11052595 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300012972|Ga0134077_10310250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300014157|Ga0134078_10580109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300015359|Ga0134085_10102209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1190 | Open in IMG/M |
| 3300018433|Ga0066667_12326091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300018468|Ga0066662_10732818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 949 | Open in IMG/M |
| 3300019888|Ga0193751_1150278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 836 | Open in IMG/M |
| 3300020581|Ga0210399_10546694 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300025910|Ga0207684_10197831 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300026301|Ga0209238_1070672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1227 | Open in IMG/M |
| 3300026306|Ga0209468_1205774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
| 3300026316|Ga0209155_1038021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1920 | Open in IMG/M |
| 3300026323|Ga0209472_1038844 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
| 3300026323|Ga0209472_1269988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 542 | Open in IMG/M |
| 3300026329|Ga0209375_1220751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300026334|Ga0209377_1129531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 997 | Open in IMG/M |
| 3300026537|Ga0209157_1254873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
| 3300026548|Ga0209161_10102518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1723 | Open in IMG/M |
| 3300026555|Ga0179593_1079719 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
| 3300027842|Ga0209580_10006628 | All Organisms → cellular organisms → Bacteria | 4951 | Open in IMG/M |
| 3300027842|Ga0209580_10110603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1334 | Open in IMG/M |
| 3300027857|Ga0209166_10717409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
| 3300027882|Ga0209590_10002661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7212 | Open in IMG/M |
| 3300027894|Ga0209068_10303765 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300028536|Ga0137415_10666349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300031736|Ga0318501_10373767 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300031792|Ga0318529_10488768 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031965|Ga0326597_10948382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 875 | Open in IMG/M |
| 3300032063|Ga0318504_10665098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
| 3300032205|Ga0307472_101153913 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.86% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.94% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.98% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_01868590 | 2189573000 | Grass Soil | AEELGDRQIPPWTWRHLAVVAELRGDNATAAEWLKRAKDAQSRGPR*RSGLQEDQRD |
| ICChiseqgaiiFebDRAFT_143579063 | 3300000363 | Soil | SWTWRALAKVSERRGNQAEAEQRIRQSHEAEAQRPR* |
| JGI12636J13339_10031601 | 3300001154 | Forest Soil | ELGDRQLPGWTWRALAKVAELRGDASAAEAHWRRSKEAESRGPH* |
| A30PFW6_10808454 | 3300001361 | Permafrost | AEEDLRHAIRIAEELGDRQLPGWTWRALAKVAELRGDGAEAEEHWRRSREAESRGPH* |
| JGI12635J15846_100031671 | 3300001593 | Forest Soil | IRIAEELGDRQLPGWTWRALAKVAELRGDASAAEAHWRRSKEAESRGPH* |
| JGI25386J43895_100521821 | 3300002912 | Grasslands Soil | EEMGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH* |
| JGI25389J43894_10569802 | 3300002916 | Grasslands Soil | IRTAEELGDRQLPPWTWRNLAEVAELRGDKAAAEELLKRSRDAESRGPH* |
| Ga0066672_106047551 | 3300005167 | Soil | RFAIRVAEELGDRQLPAWTWRNLAQVAELRGDKAAAEELLQRSKDAESRGPH* |
| Ga0066673_101683601 | 3300005175 | Soil | DLRFAIRIAEELGDRQIPGWTWRALAQVSELRGDQAEADERMRRSREAQARGPR* |
| Ga0066678_102848092 | 3300005181 | Soil | EEDLRFAIRTAEELGDRQLPAWTWRNLAKVAELRGDKAAAEELLQRSRDAELRGPH* |
| Ga0066671_101627941 | 3300005184 | Soil | RVAEELGDRQLPGWTWRALARVSELRGDQAAAEERHRRSREALIRGPR* |
| Ga0066675_103969902 | 3300005187 | Soil | AEEDLRFAIRIAEELGDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIVRGPR* |
| Ga0066388_1003937811 | 3300005332 | Tropical Forest Soil | AAIRIAEEMGDRQLPPWTWRNLAQVAELRGDKAAAEELLKRSKDAESRGPH* |
| Ga0070694_1009773571 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | AIRTAEELGDRQIPPWTWRNLAVVAELRGDNATAAEWLKRAKDAESRGPR* |
| Ga0070708_1007795841 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | RIAEELGDRQLPGWTWRALALVAERRGDKAEAEERWRRSREAESRGPH* |
| Ga0066682_101650431 | 3300005450 | Soil | AEEDLRFAIRIAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH* |
| Ga0066687_105801051 | 3300005454 | Soil | ELGDRQLPGWTWRALARVSELRGDQAAAEERHRRSREALIRGPR* |
| Ga0070706_1007083972 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GDRQLPGWTWRALARVAELRGDRAEAEERWRRSREAESRGPH* |
| Ga0070699_1009717712 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | GDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIIRGPR* |
| Ga0070699_1019597852 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IRTAEELGDRQLPPWTWRHLAIVAELRGDNATAAEWLKRAKDAESRGPR* |
| Ga0070684_1013032642 | 3300005535 | Corn Rhizosphere | RQLASWMWRALAQVSERRGDTAEAEQRLRRSREAEAKGPK* |
| Ga0066697_103445211 | 3300005540 | Soil | IRTAEEMGDRQLPPWTWRNLAKVAELRGDKAAAEELLKRSRDAESRGPH* |
| Ga0070695_1016623922 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TAEELGDRQLPPWTWRHLAVVAELRGDNATAAEWLKRAKDAESRGPR* |
| Ga0066701_109313542 | 3300005552 | Soil | GDRQLPGWTWRALALVAERRGDKAEAEERWRRSREAESRGPH* |
| Ga0066695_105585601 | 3300005553 | Soil | RAAIRIAEELGDKQLPPWTWRNLARVAELRGDKAAAEELLQRSKDAESRGPH* |
| Ga0066698_102868961 | 3300005558 | Soil | EDLRAAIRIAEELGDRQLPPWTLRNLATVAELRGDKVAAEELLKRSKDAESRGPH* |
| Ga0066700_111344171 | 3300005559 | Soil | AEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH* |
| Ga0066693_101029681 | 3300005566 | Soil | AIRVAEELGDRQLPAWTWRNLAQVAELRGDKAAAEELLQRSKDAESRGPH* |
| Ga0066703_101329671 | 3300005568 | Soil | DLKHAIRIAEELGDRQLPGWTWRALAKVSELRGDRAEAEERWRKSREAESRGPH* |
| Ga0066691_107367571 | 3300005586 | Soil | LGDRQLPAWTWRNLAKVAELRGDKAAAEELLQRSRDAELRGPH* |
| Ga0066706_106658191 | 3300005598 | Soil | FAIRIAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH* |
| Ga0066903_1027202321 | 3300005764 | Tropical Forest Soil | FAVRAAEELGDRQLPVWTWRALARVSELRGDTAEAAERLERSHEAESVGPH* |
| Ga0081538_100664801 | 3300005981 | Tabebuia Heterophylla Rhizosphere | ERQMGEWTWRAFALVAEKRGDQAEAERRWRRSREAQAQGPK* |
| Ga0079221_103275942 | 3300006804 | Agricultural Soil | WTWRNLARVAELRGDAAAAQELLARSKDAELRGPH* |
| Ga0079221_108155962 | 3300006804 | Agricultural Soil | WTWRALARVSELRGDQAEADERHRRSREALIRGPH* |
| Ga0075433_107278822 | 3300006852 | Populus Rhizosphere | GDRQIPPWTWRNLAVVAELRGDNATAAEWLKRAKDAESRGPR* |
| Ga0075433_117631151 | 3300006852 | Populus Rhizosphere | RIAEELGDRQLPPWTLRNLAKVAELRGDKVAAEELLRQSKDAESRGPH* |
| Ga0075425_1022970912 | 3300006854 | Populus Rhizosphere | PPWTLRNLAKVAELRGDKVAAEELLRQSKDAESRGPH* |
| Ga0073928_104651663 | 3300006893 | Iron-Sulfur Acid Spring | AIRIAEELGDRQLPGWTWRALAQVAELRGDGAAAEEHWRRSREAQSRGPH* |
| Ga0073928_108921651 | 3300006893 | Iron-Sulfur Acid Spring | DRQLPGWTWRALARVAELRGDGAAAEEHWRRSREAESRGPH* |
| Ga0075426_109898181 | 3300006903 | Populus Rhizosphere | RQLPPWTLRNLAKVAELRGDKVAAEELLRQSKHAESRGPH* |
| Ga0075435_1016669242 | 3300007076 | Populus Rhizosphere | TLRNLAKVAELRGDKVAAEELLRQSKHAESRGPH* |
| Ga0099794_103522731 | 3300007265 | Vadose Zone Soil | EDLRFAIRIAEELGDRQLPGWTWRALAKVAELRGDKAEAEERWRRSREAQSRGPH* |
| Ga0099795_106291232 | 3300007788 | Vadose Zone Soil | RYAIRIAEELGDRQLPGWTWRALAKVAELRGDKETAEEHWRRSREAESRGPH* |
| Ga0066710_1033843462 | 3300009012 | Grasslands Soil | FAIRIAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH |
| Ga0099830_109175291 | 3300009088 | Vadose Zone Soil | RYAIRVAEELGDRQLPGWTWRALARVAELRGDTSEAEERWRRSREAESRGPH* |
| Ga0099828_115904762 | 3300009089 | Vadose Zone Soil | LGDRQLPGWTWRALARVAELRGDKTEADERWRRSREAESRGPR* |
| Ga0099827_102341433 | 3300009090 | Vadose Zone Soil | WTWRALARVAELRGDKTEAEERWRRSREAESRGPR* |
| Ga0066709_1038993182 | 3300009137 | Grasslands Soil | EELGDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIVRGPR* |
| Ga0066709_1044299722 | 3300009137 | Grasslands Soil | ELGDRQLPAWTWRNLAQVAELRGDKAAAEELLQRSKDAESRGPH* |
| Ga0099792_109313292 | 3300009143 | Vadose Zone Soil | YAIRIAEELGDRQLPGWTWRALALVAERRGDKAEAEERWRRSREAESRGPH* |
| Ga0126382_125070681 | 3300010047 | Tropical Forest Soil | RQLPGWTWRALARVSELRGNQAEAEERHRRSREALIRGPH* |
| Ga0134086_103362562 | 3300010323 | Grasslands Soil | AEEDLRAAIRIAEELGDRQLPPWTLRNLAKVAELRGDKVAAEELLKRSKDAESRGPQ* |
| Ga0134065_100930361 | 3300010326 | Grasslands Soil | AWTWRNLAQVAELRGDKAAAEELLQRSKDAESRGPH* |
| Ga0134065_103344911 | 3300010326 | Grasslands Soil | GRLDQAEEELRFAIRTAEELGDRQLPPWTWRNLAVVAELRGDNATAAEWLQRAKDAESRGPR* |
| Ga0134063_102168792 | 3300010335 | Grasslands Soil | IAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH* |
| Ga0134071_102237532 | 3300010336 | Grasslands Soil | GDRQLPAWTWRHLAKVAELRGDKAAAEELLQRSKDAESRGPH* |
| Ga0134127_101508464 | 3300010399 | Terrestrial Soil | PSWTWRALAKVSELRGDQAEAEERYRRSKEAESRGPH* |
| Ga0137392_103080691 | 3300011269 | Vadose Zone Soil | LGDRQLPGWTWRALALVAERRGDKAEAEERWRRSREAESRGPH* |
| Ga0137391_100557241 | 3300011270 | Vadose Zone Soil | IRVAEELGDRQLPGWTWRALARVAELRGDTSEAEERWRRSREAESRGPH* |
| Ga0137391_111460441 | 3300011270 | Vadose Zone Soil | GDRQLPGWTWRALAKVAELRGDTAEAEERWRRSKEAESRGPH* |
| Ga0137393_112704762 | 3300011271 | Vadose Zone Soil | AIRIAEELGDRQLPGWTWRALAKVAELRGDGAAAEEHWRRSREAESRGPH* |
| Ga0137393_114823462 | 3300011271 | Vadose Zone Soil | RQLPGWTWRALARVAELRGDKTEAEERWRRSREAESRGPR* |
| Ga0137388_112958082 | 3300012189 | Vadose Zone Soil | FAIRIAEELGDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIIRGPR* |
| Ga0137365_101352381 | 3300012201 | Vadose Zone Soil | AEEDLRFAIRTAEELGDRQLPPWTWRNLAKVAELRGDKAAAEELLKRSRDAESRGPH* |
| Ga0137363_105986451 | 3300012202 | Vadose Zone Soil | TWRALALVAERRGDKAEAEERWRRSREAESRGPH* |
| Ga0137399_107912442 | 3300012203 | Vadose Zone Soil | IRIAEELGDRQLPGWTWRALAKVAELRGDKETAEEHWRRSREAESRGPH* |
| Ga0137374_103626782 | 3300012204 | Vadose Zone Soil | LASWTWRALAEVSERRGDKAEAEQRLRRSREAEAQGPR* |
| Ga0137376_109166492 | 3300012208 | Vadose Zone Soil | LRFAIRTAEELGDRQLPPWTWRNLAVVAELRGDNATAAEWLQRAKDAESRGPR* |
| Ga0137378_109790412 | 3300012210 | Vadose Zone Soil | AWTWRNLAKVAELRGDKAGAEELLQRSRDAELRGPH* |
| Ga0137377_116120912 | 3300012211 | Vadose Zone Soil | RFAIRTAEELGDRQLPPWTWRHLAKVAELRGDKAAAEELLKRSRDAESRGPH* |
| Ga0137372_111836602 | 3300012350 | Vadose Zone Soil | RYALKISDELGDRQLPGWTWRALARVSERRGDQAEAEERFRRSREAELRGPH* |
| Ga0137395_110525952 | 3300012917 | Vadose Zone Soil | PGWTWRALARVAELRGDKTEAEERWRRSREAESRGPR* |
| Ga0134077_103102502 | 3300012972 | Grasslands Soil | QLPPWTLRNLAKVAELRGDEVAAEELLRQSKDAESRGPH* |
| Ga0134078_105801092 | 3300014157 | Grasslands Soil | LDQAEEDLRFAIRTAEELGDRQLPPWTWRNLAEVAELRGDKAAAEELLKRSRDAESRGPH |
| Ga0134085_101022093 | 3300015359 | Grasslands Soil | ELGDRQLPPWTLRNLAKVAELRGDKVAAEELLKRSKDAESRGPH* |
| Ga0066667_123260911 | 3300018433 | Grasslands Soil | RTAEELGDRQLPPWTWRNLAVVAELRGDNATAAEWLQRAKDAESRGPR |
| Ga0066662_107328182 | 3300018468 | Grasslands Soil | EEDLRFAIRVAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH |
| Ga0193751_11502783 | 3300019888 | Soil | IRIAEELGDRQLPGWTWRALAMVAELRGDEAAAEEHWRRSKDAESRGPH |
| Ga0210399_105466942 | 3300020581 | Soil | DRQLPGWVWRALARVAELRGDKTEAEERLRRSREAESRGPR |
| Ga0207684_101978314 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EEDLQFAVRVAEELGDRQLPVWTWRALARVSELRGDSAQAEERRRRSHQAESVGPH |
| Ga0209238_10706721 | 3300026301 | Grasslands Soil | EDLRFAIRTAEELGDRQLPPWTWRNLAEVAELRGDKAAAEELLKRSRDAESRGPH |
| Ga0209468_12057742 | 3300026306 | Soil | QLPPWTWRNLAEVAELRGDKAAAEELLKRSRDAESRGPH |
| Ga0209155_10380211 | 3300026316 | Soil | LRFAIRTAEELGDRQLPPWTWRNLAVVAELRGDNATAAEWLQRAKDAESRGPR |
| Ga0209472_10388441 | 3300026323 | Soil | AEELGDRQLPAWTWRNLAKVAELRGDKAAAEELLRRSQDAESRGPH |
| Ga0209472_12699882 | 3300026323 | Soil | EMGDRQLPPWTWRNLAKVAELRGDKAAAEELLKRSRDAESRGPH |
| Ga0209375_12207511 | 3300026329 | Soil | WTWRNLAKVAELRGDKAAAEELLQRSLDAESRGPH |
| Ga0209377_11295311 | 3300026334 | Soil | AIRIAEDLGDRQLPAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH |
| Ga0209157_12548731 | 3300026537 | Soil | DRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIVRGPR |
| Ga0209161_101025183 | 3300026548 | Soil | PAWTWRNLAKVAELRGDKVAAEELLQRSKDAESRGPH |
| Ga0179593_10797197 | 3300026555 | Vadose Zone Soil | DDGTWRALAKVSEQRGDQAEADERMRRSREAQARGPR |
| Ga0209580_100066281 | 3300027842 | Surface Soil | LPGWTWRNLARVAELRGDKAEAEELMRRSREAESRGPH |
| Ga0209580_101106031 | 3300027842 | Surface Soil | LPGWTLRHLARVMELRGDKAEAEELLRRSHQAESQSPR |
| Ga0209166_107174092 | 3300027857 | Surface Soil | EELGDRQLPGWTWRALARVSELRGDQAEADERMRRSREAQARGPR |
| Ga0209590_100026619 | 3300027882 | Vadose Zone Soil | EDLRFAIRIAEELGDRQLPGWTWRALARVSELRGDQAEAEERHRRSREAIIRGPR |
| Ga0209068_103037651 | 3300027894 | Watersheds | AEDLGDRQLPGWTWRALARVAELRGDSPEAEERWRRSLEAESRGPH |
| Ga0137415_106663491 | 3300028536 | Vadose Zone Soil | AEELGDRQLPGWTWRALAKVAELRGDKETAEEHWRRSREAESRGPH |
| Ga0318501_103737671 | 3300031736 | Soil | AIRIAEELGDRQLPAWTWRNLARVAELRGDAAAAEELLARSKDAELRGPH |
| Ga0318529_104887681 | 3300031792 | Soil | PVAGELGDRQLPSWTWRALARISELRGDVAQAEERTRRSEEAESVGPH |
| Ga0326597_109483822 | 3300031965 | Soil | ERQLASWTWRALAKVSERRGDTAEAERRLRRSREAEAQGPR |
| Ga0318504_106650982 | 3300032063 | Soil | RIAEELGDRQLPAWTWRNLARVAELRGDAAAAEELLARSKDAELRGPH |
| Ga0307472_1011539131 | 3300032205 | Hardwood Forest Soil | DRQLPVWTWRALARVSELRGDTAGADERRQRSQQAESIGPH |
| ⦗Top⦘ |