 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F102143 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKKVTKSIRIDPDLWHKARVKALAEKMTLQDLIAKLLTEYLKKKKGE |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (21.569 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.569 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (31.373 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 9.80 |
| PF07589 | PEP-CTERM | 3.92 |
| PF14659 | Phage_int_SAM_3 | 2.94 |
| PF16697 | Yop-YscD_cpl | 0.98 |
| PF13932 | GIDA_C | 0.98 |
| PF00582 | Usp | 0.98 |
| PF12773 | DZR | 0.98 |
| PF07238 | PilZ | 0.98 |
| PF14657 | Arm-DNA-bind_4 | 0.98 |
| PF01476 | LysM | 0.98 |
| PF04343 | DUF488 | 0.98 |
| PF02768 | DNA_pol3_beta_3 | 0.98 |
| PF12161 | HsdM_N | 0.98 |
| PF04452 | Methyltrans_RNA | 0.98 |
| PF12651 | RHH_3 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.98 |
| COG1385 | 16S rRNA U1498 N3-methylase RsmE | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 21.57% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 11.76% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 7.84% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 5.88% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 4.90% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 3.92% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 3.92% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.94% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.94% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.94% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.94% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.96% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.96% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 1.96% |
| Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 1.96% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.96% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.96% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.96% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.98% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.98% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.98% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.98% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.98% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 0.98% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.98% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.98% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2100351012 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from low methane PC12-244-90cm | Environmental | Open in IMG/M |
| 3300000229 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
| 3300003910 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW | Environmental | Open in IMG/M |
| 3300004008 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 | Environmental | Open in IMG/M |
| 3300004076 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005917 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKH | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009008 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009320 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300014911 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay16, Core 4569-2, 12-15 cm | Environmental | Open in IMG/M |
| 3300014913 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cm | Environmental | Open in IMG/M |
| 3300015370 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300022307 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025586 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKG (SPAdes) | Environmental | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300029827 | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 | Environmental | Open in IMG/M |
| 3300031331 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-150 | Environmental | Open in IMG/M |
| 3300031577 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ASLM90b_02337640 | 2100351012 | Coastal Water And Sediment | MKIVSKSIRIDPDLWQQARAKALGEGMTMQDLITKLLTEYLKKKGGK |
| TB_LI09_3DRAFT_10059953 | 3300000229 | Groundwater | MERVTKSLKIDPELWHRARVKALSENMTMQQLILKLLTEYLGEGKKKATK* |
| JGIcombinedJ13530_1019177232 | 3300001213 | Wetland | MEIVTKSIRVDPELWHRAKVKALTEKTTMQDLIAKLLTEYLKKGGK* |
| BBDRAFT_103276536 | 3300001371 | Marine Estuarine | MDKVTKSIRIDPELWHKARVKALSERMTLQDLIASLLTEYLKEKERG* |
| BBDRAFT_103867333 | 3300001371 | Marine Estuarine | GNEMKIVPKTVRVDYGLWQKARSKALAEGMTMQDLVAKLLTEYLKKGGKYP* |
| JGI26437J51864_100052035 | 3300003910 | Freshwater Lake Sediment | MEKVVKSVKIDPELWHRAKVRALSEKMTVQQLIVKLLTEYLGEGKKKGGK* |
| Ga0055446_100389772 | 3300004008 | Natural And Restored Wetlands | MENLVPKTIRIDPILWHKARVKALSENMTLQDLILKLLEGYLGKEAN* |
| Ga0055522_100854742 | 3300004076 | Natural And Restored Wetlands | MENLVPKTIRIDPTLWHKARVKALSENMTLQDLILKLLEEYLGKEAS* |
| Ga0070727_103201652 | 3300005590 | Marine Sediment | MKGVAKTIRIDPELWHKARVKALTRGMTLQDLISKLIREYLGKEDK* |
| Ga0070727_106562582 | 3300005590 | Marine Sediment | GSRQMKLVTKSIRIDPDLWHRARVKALAEKMTLQDLITRLLKEYLGEK* |
| Ga0074473_104239994 | 3300005830 | Sediment (Intertidal) | MSEMISKSVRVDRDLWQSARARALSENKTMQELIKDLLTEYLKKKGGK* |
| Ga0074469_105699514 | 3300005832 | Sediment (Intertidal) | MDKITKSIRIDPELWHKARVKALSERMTLQDLIASLLTEYLKEKERG* |
| Ga0074469_106998516 | 3300005832 | Sediment (Intertidal) | MKIVPKTVRVDYGLWQKARSKALAEGMTMQDLVAKLLTEYLKKGGKYP* |
| Ga0074469_108748612 | 3300005832 | Sediment (Intertidal) | MAIKSVRIDPDLWQQARAKALGEGMTMQDLITKLLTEYLKKKGGK* |
| Ga0075115_100822762 | 3300005917 | Saline Lake | VVKVKLVSKSIKIDPELWHEARVKAMAERMTLQELIAKLLTEYLKNKGR* |
| Ga0079037_1005366562 | 3300006224 | Freshwater Wetlands | MEKVVKSVKVDPELWHRAKVRALSEKMTVQQLIVKLLTEYLGEGKKKGGR* |
| Ga0079037_1011753222 | 3300006224 | Freshwater Wetlands | MEIVTKSIRVDPDLWRQVRSKAVGEGMTMQDLITRLFLDYLKEGKKEGR* |
| Ga0079037_1012191531 | 3300006224 | Freshwater Wetlands | VKLLKRGYGMEKVVKSVKIDPELWHRAKVRALSEKMTVQQLIVKLLTEYLGEGKKKGGK* |
| Ga0079037_1018574292 | 3300006224 | Freshwater Wetlands | MELVAKSIRIDPELWRKARAKAINDKLTMQDLITKLLTEYLKKGGK* |
| Ga0079037_1018648041 | 3300006224 | Freshwater Wetlands | NEMEIVTKSIRVDPELWHKAKVKALTEKTTMQDLITRLLTEYLKKGGK* |
| Ga0079037_1025038541 | 3300006224 | Freshwater Wetlands | MLKVTKSLKIDPELWHRARVKALSENMTLQELIVKLLTEYLKKEGKGKA* |
| Ga0099972_101138422 | 3300006467 | Marine | MKRVTKSLRIDPDLWHKARVKALAEKMTLQDLIEKLLKEYLKKK* |
| Ga0099972_101280331 | 3300006467 | Marine | DMKGVAKTIRIDPELWHKARVKALTRGMTLQDLISKLIREYLGKEDK* |
| Ga0079303_103466192 | 3300006930 | Deep Subsurface | MEKVVKSVKVDPELWHRAKVRALSEKMTVQQLIVKLLTEYLGEGKKRGVKP* |
| Ga0115649_13049641 | 3300009008 | Marine | VELVTKSIKVDPELWHKARVKALSKKMTLQELIPRLLKQYLEDEGDD* |
| Ga0115863_102212911 | 3300009034 | Sediment, Intertidal | MNKVTKSIKIDPELWHKARVKALGENMTLQDLIAKLLTEYLKRKRR* |
| Ga0115863_15196972 | 3300009034 | Sediment, Intertidal | MKVVSKSIRVDPELWHKARIKALAEGMTMQDLIEELLIEYLKKKRG* |
| Ga0102851_110382274 | 3300009091 | Freshwater Wetlands | MEKISKSIRIDPELWHKAKVKALTERITMQDLITRLL |
| Ga0102851_123214612 | 3300009091 | Freshwater Wetlands | MLKVTKSLKIDPGLWHRARVKALSENMTLQELIVKLLTEYLGEGKKKGGK* |
| Ga0102851_125895112 | 3300009091 | Freshwater Wetlands | VQKVTKSIRIDTDLWRRARAKGLAEGKTMQQLITDLLRQYLGEGGE* |
| Ga0115027_101448151 | 3300009131 | Wetland | LLKVTKSLKIDPELWHRARVKALSENMTLQELIVKLLTEYLKKE |
| Ga0114921_110998901 | 3300009150 | Deep Subsurface | MEKVTKSIRIDPDLWHKARVKALAEGMTLQDLITKLLTEYLKKKKGR* |
| Ga0113563_108389024 | 3300009167 | Freshwater Wetlands | VDPELWHRAKVKALTEKTTMQDLIAKLLTEYLKKGGK* |
| Ga0113563_108871782 | 3300009167 | Freshwater Wetlands | MGLVAKSIRIDPELWRKARAKAINDKLTMQDLITKLLTEYLKKGGK* |
| Ga0105097_108287392 | 3300009169 | Freshwater Sediment | MERVIKSVKIDPELWHRARVKALSENMTVQQLIVKLFTEYLGEGKKKGGK* |
| Ga0115028_109471422 | 3300009179 | Wetland | MEIVTKSIRVDPELWHKAKVKALTEKTTMQDLIAKLPT* |
| Ga0117909_11132022 | 3300009320 | Marine | MNKVVTKSVKIEHDIWHKARVKALGQGLTMQDLVAKLLTKYLDSQKKGGK* |
| Ga0117909_14196311 | 3300009320 | Marine | LKKVTKSIRIDPDLWLKARVKALAEGMSMQDLITKLLTEYLKKKGGA* |
| Ga0114925_102925302 | 3300009488 | Deep Subsurface | MKKVTKSIRIDPDLWHKARVKALAEKMTLQDLIAKLLTEYLKKKKGE* |
| Ga0118657_105880932 | 3300009506 | Mangrove Sediment | MDRVTKSIKIDPDLWHRARVKALAEKMTLQDLIAKLLQEYLGEEKRR* |
| Ga0123573_108412931 | 3300009509 | Mangrove Sediment | IRIDPILWHKARVKALSENMTLQDLILKLLEEYLGKEAN* |
| Ga0123573_111948721 | 3300009509 | Mangrove Sediment | MDKVTKSIKIDPDLWHRARVKALAEKMTLQDLIAKLLQEYLGEEKRR* |
| Ga0136651_106324351 | 3300010330 | Marine Hydrothermal Vent | IKVDPDLWHKARVKALSENMTLQELIARLLREYLKEKRGK* |
| Ga0118731_1005933631 | 3300010392 | Marine | MKGIAKTIRIDPELWHKARVKALTRGMTLQDLISKL |
| Ga0118731_1047945382 | 3300010392 | Marine | MAEVNKSVRVDAELWQKARAKALGEGKTMQTLIKDLLTAYLKKGGK* |
| Ga0118731_1085640621 | 3300010392 | Marine | MKRVTKSLRIDPDLWHKARVKALAEKMTLQDLIEKLLKEYLKKKLKGGD* |
| Ga0136851_100833371 | 3300010413 | Mangrove Sediment | MDKVTKSIKIDPDLWLRARVKALAEKMTLQDLIAKLLQEYLGEEKRR* |
| Ga0136851_108127672 | 3300010413 | Mangrove Sediment | MDKVTKSIKIEPDLWHRARVKALAEKMTLQDLIAKLLQEYLGEEKRR* |
| Ga0136851_111072411 | 3300010413 | Mangrove Sediment | LLFYKRYKRKRCRMDRVTKSIKIDPDLWHRARVKALAEKMTLQELIAKLLQEYLGEEKRR |
| Ga0136851_113590602 | 3300010413 | Mangrove Sediment | RKRCCMDKVTKSIKIDPDLWHRARVKALAEKMTLQDLIAKLLQEYLGEEKRR* |
| Ga0118733_1046129492 | 3300010430 | Marine Sediment | MTEVNKSVRVDAELWQKARAKALGEGKTMQTLIKDLLAAYLKKKGG* |
| Ga0118733_1047179021 | 3300010430 | Marine Sediment | MKRVTKSLRIDPDLWHKARVKALAEEMTLQDLIEKLLKEYLKKK* |
| Ga0164320_102323321 | 3300013098 | Marine Sediment | MKGVGKTIRIDTELWHKDRVKALTRGMTLQDLISKLIREYLGKEDK* |
| Ga0164321_107587212 | 3300014903 | Marine Sediment | MKGVAKTIRIDPELWHKARVKALSENMTLQDLILKLLEGYLGKEAN* |
| Ga0180301_100294043 | 3300014911 | Marine Sediment | MKMVTKSIKVDPDLWHKARVKALSENMTLQELIARLLKEYLKEKRGK* |
| Ga0164310_104215463 | 3300014913 | Marine Sediment | MKMVTKSIKIDPDLWHKARVKAMSENMTLQELIARLLKEYLKEKRGK* |
| Ga0180009_100812322 | 3300015370 | Groundwater | MDKVTKSIRIDPELWHKARVKALSERMTLQDLVAVLLTEYLKEKGVK* |
| Ga0180437_102295072 | 3300017963 | Hypersaline Lake Sediment | MKMAKLEKITKSIKIDPELWHRARVKALGEKKTLQDLIAELLTEYLRKKGGKK |
| Ga0180438_100460451 | 3300017971 | Hypersaline Lake Sediment | KVMKMAKLEKITKSIKIDPELWHRARVKALGEKKTLQDLIAELLTEYLRKQGGKK |
| Ga0224507_100498932 | 3300022307 | Sediment | MDKVTKSIRIDPELWHKARVKALSERMTLQDLIASLLTEYLKEKERG |
| (restricted) Ga0233412_104106332 | 3300023210 | Seawater | MVNLVPKTIRIDPTLWHKARVKALSENMTLQDLILKLLERYLGKEAN |
| Ga0124853_10564842 | 3300024056 | Freshwater Wetlands | MEKVVKSVKIDPELWHRAKVRALSEKMTVQQLIVKLLTEYLGEGKKKGGK |
| Ga0209977_102603911 | 3300024432 | Deep Subsurface | MKKVTKSIRIDPDLWHKARVKALAEKMTLQDLIAKLLTEYLKKKKGE |
| (restricted) Ga0255044_104465352 | 3300024529 | Seawater | MKGVPKTIRIDPELWHKARVKALTRGMTLQDLISKLIREYLGKEDK |
| Ga0207996_10132665 | 3300025586 | Saline Lake | VKLVSKSIKIDPELWHEARVKAMAERMTLQELIAKLLTEYLKNKGR |
| Ga0209286_10964432 | 3300027713 | Freshwater Sediment | MERVIKSVKIDPELWHRARVKALSENMTVQQLIVKLFTEYLGEGKKKGGK |
| Ga0209379_103180621 | 3300027758 | Marine Sediment | MKRVTKSLRIDPDLWHKARVKALAEKMTLQDLIEKLLKEYLKKK |
| Ga0209287_101764291 | 3300027792 | Freshwater Sediment | KITKSIRIDPELWHKARVKALSEKTTMQDLITRLLTEYLKKGGK |
| Ga0209578_102261321 | 3300027820 | Marine Sediment | MKGIAKTIRIDPELWHKARVKALTRGMTLQDLISKLIREYLGKEDK |
| Ga0209293_104049762 | 3300027877 | Wetland | MEIVTKSIRVDPELWHKAKVKALTEKTTMQDLIAKLLTEYLKKGGK |
| Ga0209450_100217546 | 3300027885 | Freshwater Lake Sediment | MELAAKSIRVEPELWRKARAKAVGEGMTMQDLITKLLTDYLKEGKKGGK |
| Ga0209450_100325977 | 3300027885 | Freshwater Lake Sediment | MEIVTKSIRVDPELWHRAKVKALTEKTTMQDLIAKLLTEYLKKGGKWDGCHN |
| Ga0209496_108032672 | 3300027890 | Wetland | VTKSIRVDPELWHRAKVKALTEKTTMQDLIAKLLTEYLKKGGK |
| Ga0209427_106108381 | 3300027901 | Marine Sediment | MTKLEKITKSIKIDPELWHRARVKALGEKKTLQDLIAELLTEYLRKKGGKK |
| Ga0209427_111958601 | 3300027901 | Marine Sediment | MADMVTKSIRIDPDLWLKARVKALADGMTMQDLVTKLLMEYLKKKGE |
| Ga0134606_100110283 | 3300029827 | Marine Sediment | MERVTKSIKIDPELWHRARVKALSENMTLQELIAKLLKEYLGEKGGK |
| Ga0134606_100306404 | 3300029827 | Marine Sediment | MDKVTKSIKIDPDLWLRARVKALAEKMTLQDLIAKLLQEYLGEKKRR |
| Ga0307432_10593692 | 3300031331 | Salt Marsh | MEKIARSIKVDPDLWHKARVKALSEGMTVQDLMANLLTEYLK |
| Ga0316602_100118011 | 3300031577 | Soil | MEIVTKSIRVDPELWHRAKVKALTEKTTMQDLIAKLLTEYLKKGGK |
| Ga0316187_109053432 | 3300032231 | Worm Burrow | KTIRIDPELWHKARVKALSENMTLQDLILKLLEGYLGKEAN |
| Ga0316190_108018082 | 3300032259 | Worm Burrow | MKGVAKTIRIDPELWHKARVKALSENMTLQDLILKLLEGYLGKEAN |
| Ga0316604_102646992 | 3300033406 | Soil | MKKGNEMEIVTKSIRVDPELWHKAKVKALTEKTTMQDLITRLLTEYLKKGGK |
| Ga0316604_104705702 | 3300033406 | Soil | MEIVTKSIRVDPELWHRAKVKALTEKTTMQDLIAKLL |
| Ga0316604_105439752 | 3300033406 | Soil | MELVAKSIRIDPELWRKARAKAINDKLTMQDLITKLLTEYLKKGGK |
| Ga0316605_105944072 | 3300033408 | Soil | MLKVTKSLKIDPELWHRARVKALSENMTLQELIVKLLTEYLKKEGKGKA |
| Ga0316605_109427921 | 3300033408 | Soil | MEIVTKSIRVDPELWHRAKVKALTEKTTMQDLIAKLLTEYLK |
| Ga0316619_112281102 | 3300033414 | Soil | MLKVTKSLKIDPELWHRARVKALSENMTLQELIVKLLTEYLKKGGKGKA |
| Ga0316619_114693181 | 3300033414 | Soil | IVTKSIRVDPELWHKAKVKALTEKTTMQDLIAKLLT |
| Ga0316625_1021999821 | 3300033418 | Soil | MEKGVKTIRVDPDLWRRARAKALNEKTTMQDLITKLLTEYLKKGGKGKA |
| Ga0316601_1001512443 | 3300033419 | Soil | MEKVVKSVKVDPELWHRAKVRALSEKMTVQQLIVKLLTEYLGEGKKKGGK |
| Ga0316601_1001682495 | 3300033419 | Soil | MGLVAKSIRIDPELWRKARAKAINDKLTMQDLITKLLTEYLKKGGK |
| Ga0316601_1002259276 | 3300033419 | Soil | VDPELWHRAKVKALTEKTTMQDLIAKLLTEYLKKGGK |
| Ga0316601_1007378281 | 3300033419 | Soil | KVTKSLKIDPELWHRARVKALSENMTLQELIVKLLTEYLKKEGKGKA |
| Ga0316601_1024592081 | 3300033419 | Soil | VQKVTKSIRIDTDLWRRARAKGLAEGKTMQQLITDLLRQYLGEGGE |
| Ga0316613_108938601 | 3300033434 | Soil | MLKVTKSLKIDPELWHRARVKALSENMTLQELIVKLLTEYLKKGGKS |
| Ga0316620_104726871 | 3300033480 | Soil | MEIVTKSIRVDPELWHKAKVKALIEKTTMQDLIAKLLTEYLKKGGK |
| Ga0316600_104305181 | 3300033481 | Soil | MDKITKSIRIDPGLWHKARVKALSEKTTMQDLITRLLTEYLKKGGK |
| Ga0316626_117687862 | 3300033485 | Soil | KKWGNGMEIVTKSIRVDPELWHRAKVKALTEKTTMQDLIAKLLTEYLKKGGK |
| Ga0316624_105923722 | 3300033486 | Soil | MEIVTKSIRVDPELWHKAKVKALIEKTTMQDLIANLLTEYLKKGGK |
| Ga0316630_102078311 | 3300033487 | Soil | MEKVVKSVKIDPELWHRAKVRALSEKMTVQQLIVKLLTEY |
| Ga0316630_106060123 | 3300033487 | Soil | MLKVTKSLKIDPGLWHRARVKALSENMTLQELIVKLLTEYLGEGKKKGGK |
| Ga0316617_1001409701 | 3300033557 | Soil | KRGYEMEKVVKSVKVDPELWHRAKVRALSEKMTVQQLIVKLLTEYLGEGKKKGGR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |