Basic Information | |
---|---|
Family ID | F102129 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 42 residues |
Representative Sequence | IASRYLGPEAGAAYAERGNDDLLIRLEPGDLRAWDFADDL |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.94 % |
% of genes near scaffold ends (potentially truncated) | 96.08 % |
% of genes from short scaffolds (< 2000 bps) | 92.16 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.255 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.765 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.490 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.863 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.71% β-sheet: 17.65% Coil/Unstructured: 67.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF12833 | HTH_18 | 7.84 |
PF13091 | PLDc_2 | 4.90 |
PF01872 | RibD_C | 2.94 |
PF08281 | Sigma70_r4_2 | 1.96 |
PF00903 | Glyoxalase | 1.96 |
PF03992 | ABM | 1.96 |
PF08241 | Methyltransf_11 | 1.96 |
PF07883 | Cupin_2 | 1.96 |
PF13539 | Peptidase_M15_4 | 1.96 |
PF02592 | Vut_1 | 0.98 |
PF02361 | CbiQ | 0.98 |
PF00392 | GntR | 0.98 |
PF08450 | SGL | 0.98 |
PF04978 | DUF664 | 0.98 |
PF14742 | GDE_N_bis | 0.98 |
PF12724 | Flavodoxin_5 | 0.98 |
PF07969 | Amidohydro_3 | 0.98 |
PF06745 | ATPase | 0.98 |
PF07676 | PD40 | 0.98 |
PF13508 | Acetyltransf_7 | 0.98 |
PF12681 | Glyoxalase_2 | 0.98 |
PF08240 | ADH_N | 0.98 |
PF07690 | MFS_1 | 0.98 |
PF02899 | Phage_int_SAM_1 | 0.98 |
PF08447 | PAS_3 | 0.98 |
PF09285 | Elong-fact-P_C | 0.98 |
PF01810 | LysE | 0.98 |
PF12802 | MarR_2 | 0.98 |
PF00072 | Response_reg | 0.98 |
PF00106 | adh_short | 0.98 |
PF13191 | AAA_16 | 0.98 |
PF00719 | Pyrophosphatase | 0.98 |
PF00891 | Methyltransf_2 | 0.98 |
PF00501 | AMP-binding | 0.98 |
PF00196 | GerE | 0.98 |
PF13432 | TPR_16 | 0.98 |
PF04229 | GrpB | 0.98 |
PF02538 | Hydantoinase_B | 0.98 |
PF04075 | F420H2_quin_red | 0.98 |
PF01042 | Ribonuc_L-PSP | 0.98 |
PF01546 | Peptidase_M20 | 0.98 |
PF01636 | APH | 0.98 |
PF01243 | Putative_PNPOx | 0.98 |
PF04261 | Dyp_perox | 0.98 |
PF13302 | Acetyltransf_3 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.94 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.94 |
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.96 |
COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.98 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.98 |
COG0619 | ECF-type transporter transmembrane protein EcfT | Coenzyme transport and metabolism [H] | 0.98 |
COG1738 | Queuosine precursor transporter YhhQ, DUF165 family | Translation, ribosomal structure and biogenesis [J] | 0.98 |
COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.98 |
COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.98 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.98 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.98 |
COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.98 |
COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.25 % |
Unclassified | root | N/A | 12.75 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig90376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
3300000956|JGI10216J12902_106275504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 691 | Open in IMG/M |
3300001384|JGI20190J14840_1011197 | Not Available | 834 | Open in IMG/M |
3300001686|C688J18823_10428116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 854 | Open in IMG/M |
3300002568|C688J35102_120384259 | Not Available | 1029 | Open in IMG/M |
3300004157|Ga0062590_102908432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
3300004643|Ga0062591_102996706 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005332|Ga0066388_100756540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1571 | Open in IMG/M |
3300005435|Ga0070714_100842460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 889 | Open in IMG/M |
3300005540|Ga0066697_10236813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1083 | Open in IMG/M |
3300005547|Ga0070693_100543347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 831 | Open in IMG/M |
3300005556|Ga0066707_10291884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
3300005598|Ga0066706_10482151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
3300005764|Ga0066903_109117488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 501 | Open in IMG/M |
3300005937|Ga0081455_10061333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3165 | Open in IMG/M |
3300005937|Ga0081455_10474118 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300006046|Ga0066652_101828064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
3300006573|Ga0074055_11599866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces alboflavus | 896 | Open in IMG/M |
3300006575|Ga0074053_11713542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces alboflavus | 893 | Open in IMG/M |
3300006605|Ga0074057_12101419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2087 | Open in IMG/M |
3300006791|Ga0066653_10293746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 821 | Open in IMG/M |
3300006804|Ga0079221_11532054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300006852|Ga0075433_11137182 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300006854|Ga0075425_101042538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
3300006904|Ga0075424_101626670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
3300006904|Ga0075424_102650165 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300006914|Ga0075436_100767519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 717 | Open in IMG/M |
3300006954|Ga0079219_12004086 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300009098|Ga0105245_11249730 | Not Available | 791 | Open in IMG/M |
3300009137|Ga0066709_100107459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3443 | Open in IMG/M |
3300009522|Ga0116218_1131086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1140 | Open in IMG/M |
3300009553|Ga0105249_11111897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 860 | Open in IMG/M |
3300009553|Ga0105249_11269037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 808 | Open in IMG/M |
3300009792|Ga0126374_11104980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
3300009792|Ga0126374_11429465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300010039|Ga0126309_11193854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
3300010323|Ga0134086_10039973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1569 | Open in IMG/M |
3300010333|Ga0134080_10556073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300010337|Ga0134062_10419510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
3300010358|Ga0126370_12338391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 529 | Open in IMG/M |
3300010359|Ga0126376_11281399 | Not Available | 752 | Open in IMG/M |
3300010361|Ga0126378_10342157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1605 | Open in IMG/M |
3300010366|Ga0126379_12077080 | Not Available | 670 | Open in IMG/M |
3300010375|Ga0105239_12201834 | Not Available | 641 | Open in IMG/M |
3300010400|Ga0134122_11527383 | Not Available | 688 | Open in IMG/M |
3300010401|Ga0134121_10591350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1037 | Open in IMG/M |
3300010401|Ga0134121_11242996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 204708 | 747 | Open in IMG/M |
3300010880|Ga0126350_11400402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
3300011271|Ga0137393_10059835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3007 | Open in IMG/M |
3300012198|Ga0137364_10816176 | Not Available | 705 | Open in IMG/M |
3300012201|Ga0137365_10588320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 816 | Open in IMG/M |
3300012204|Ga0137374_11161228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
3300012207|Ga0137381_10422110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1164 | Open in IMG/M |
3300012351|Ga0137386_11114430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
3300012355|Ga0137369_10119891 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
3300012358|Ga0137368_10780230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
3300012503|Ga0157313_1014894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
3300012896|Ga0157303_10007536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1558 | Open in IMG/M |
3300012898|Ga0157293_10011774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1445 | Open in IMG/M |
3300012911|Ga0157301_10205515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
3300012986|Ga0164304_11682857 | Not Available | 530 | Open in IMG/M |
3300013308|Ga0157375_12845101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
3300014166|Ga0134079_10384998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
3300015200|Ga0173480_10699181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300017995|Ga0187816_10437914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ES1 | 584 | Open in IMG/M |
3300018001|Ga0187815_10487000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300018433|Ga0066667_11156833 | Not Available | 671 | Open in IMG/M |
3300018482|Ga0066669_11404625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 633 | Open in IMG/M |
3300020581|Ga0210399_10271898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1414 | Open in IMG/M |
3300021181|Ga0210388_10731014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 861 | Open in IMG/M |
3300021478|Ga0210402_10437574 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300023062|Ga0247791_1093319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
3300025321|Ga0207656_10293776 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Rhodothermaeota → Rhodothermia → Rhodothermales → Salisaetaceae → Longibacter → Longibacter salinarum | 803 | Open in IMG/M |
3300025905|Ga0207685_10452156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
3300025905|Ga0207685_10773799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
3300025906|Ga0207699_11156898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
3300025931|Ga0207644_10635571 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300025935|Ga0207709_11826349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
3300026118|Ga0207675_100423855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1315 | Open in IMG/M |
3300026118|Ga0207675_100457003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1266 | Open in IMG/M |
3300027718|Ga0209795_10145652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 669 | Open in IMG/M |
3300027775|Ga0209177_10319344 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300028707|Ga0307291_1008703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2188 | Open in IMG/M |
3300028716|Ga0307311_10208450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300028754|Ga0307297_10377136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
3300028755|Ga0307316_10302330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
3300028787|Ga0307323_10004418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4566 | Open in IMG/M |
3300028807|Ga0307305_10389383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
3300028878|Ga0307278_10532163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
3300031720|Ga0307469_12227464 | Not Available | 534 | Open in IMG/M |
3300031744|Ga0306918_10193508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1529 | Open in IMG/M |
3300031771|Ga0318546_10499231 | Not Available | 854 | Open in IMG/M |
3300031879|Ga0306919_11013607 | Not Available | 635 | Open in IMG/M |
3300031912|Ga0306921_11955237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
3300031938|Ga0308175_101755099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 695 | Open in IMG/M |
3300031939|Ga0308174_10479230 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300032063|Ga0318504_10211944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 906 | Open in IMG/M |
3300032122|Ga0310895_10582408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
3300032205|Ga0307472_101093204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
3300032805|Ga0335078_10109221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3979 | Open in IMG/M |
3300032892|Ga0335081_11642990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 703 | Open in IMG/M |
3300032954|Ga0335083_10907980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.76% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.86% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.98% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.98% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001384 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_05222990 | 2124908045 | Soil | HSIAIRYLGERDGAAYADGGEDDTLIRLEPGRLRAWDFADQF |
JGI10216J12902_1062755042 | 3300000956 | Soil | IRIASRYLGPQAAAEYAESGGDDLIVRLEPGHLRAWDFADSVD* |
JGI20190J14840_10111973 | 3300001384 | Arctic Peat Soil | YLGREAGAAYADRAEDDLLIRLEPGDLRAWDFADELS* |
C688J18823_104281161 | 3300001686 | Soil | HAVRDIASRYLGDDEGGAYADRGSDDTLIRLEPGDLRAWDFADDL* |
C688J35102_1203842593 | 3300002568 | Soil | LAHADASAVRDIASRYLGDDEGSAYADRGSDDTLIRLEPRDLRAWDFADDL* |
Ga0062590_1029084321 | 3300004157 | Soil | RYLGREAGIAYVAEGSDDLLVRLEPGTLRAWDFADEFGVSA* |
Ga0062591_1029967062 | 3300004643 | Soil | RIAARYLGPEAGQRYAETAGDDLLIRLEPGELRGWDFADDFT* |
Ga0066388_1007565403 | 3300005332 | Tropical Forest Soil | KRIASRYLGVEAGSAYAERGGDDLLIRLELGDLRGWDFADDFS* |
Ga0070714_1008424602 | 3300005435 | Agricultural Soil | ADVLEIAVRYLGEEEGGAYAAGGEDDTLIRLEPGRLRAWDFVDDL* |
Ga0066697_102368131 | 3300005540 | Soil | AVERIAKRYLGSPGGETYAESAGDDLLIRLEPGTLRTWDFADEFEVPG* |
Ga0070693_1005433472 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | IAARYLGQEAGERYAESAGDDLLIRLEPGQLRAWDFSDYFA* |
Ga0066707_102918843 | 3300005556 | Soil | GGETYAASAGDDLLIRLEPGTLRTWDFADEFEVSG* |
Ga0066706_104821511 | 3300005598 | Soil | YLGEEAGAAYAERMRDDVVVRLEPGGLRAWDFSDESA* |
Ga0066903_1091174882 | 3300005764 | Tropical Forest Soil | HYLGPEAGPAYAARSGDDLLVRLEPETLRAWDFADEYA* |
Ga0081455_100613335 | 3300005937 | Tabebuia Heterophylla Rhizosphere | LGAELGEQYAETDADDLLVRLEPGELRGWDFADDFA* |
Ga0081455_104741181 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RIAARYLGPEFGEQYAETDADDLLIRLEPGELRGWDFADDFA* |
Ga0066652_1018280642 | 3300006046 | Soil | IAVRYLGERDGAAYADRAGDDTLIRLEPGRLRAWDFADDL* |
Ga0074055_115998662 | 3300006573 | Soil | DTVREIAARYLGDVEGGAYADRGYDDTLIRLEPGRLRAWDFADDL* |
Ga0074053_117135421 | 3300006575 | Soil | AARYLGDVEGGAYADRGYDDTLIRLEPGRLRAWDFADDL* |
Ga0074057_121014193 | 3300006605 | Soil | VIGRAGADTVREIAARYLGDVEGGAYADRGYDDTLIRLEPGRLRAWDFADDL* |
Ga0066653_102937463 | 3300006791 | Soil | GPEAGDRYAETAGDDLLIRLEPGELRGWDFADYFA* |
Ga0079221_115320542 | 3300006804 | Agricultural Soil | RIAVRYLGPEEGERYVAGGGDDLLIRLEPGKLRAWDFADDF* |
Ga0075433_111371821 | 3300006852 | Populus Rhizosphere | RRIATRYLGPEAGQRYGETAGDDLLIRLEPGELRGWDFADDFAG* |
Ga0075425_1010425383 | 3300006854 | Populus Rhizosphere | RRIAIRYLGPEAGERYAETAGDDLLIRLEPGKLRGWDFADDFA* |
Ga0075424_1016266701 | 3300006904 | Populus Rhizosphere | IVRRIASRYLGPEAGQRYGETAGDDLLIRLEPGELRGWDFADDFAG* |
Ga0075424_1026501652 | 3300006904 | Populus Rhizosphere | SIVRRIAARYLGPEAGQRYAETAGDDLLIRLEPGELRGWDFADDFT* |
Ga0075436_1007675192 | 3300006914 | Populus Rhizosphere | TEDRSIVRRIAARYLGPEFGEEYAGTDADDLLIRLEPGELRGWDFADDFA* |
Ga0079219_120040861 | 3300006954 | Agricultural Soil | PDEGQRYDETAGDDLLIRLEPGELRGWDFADHFAG* |
Ga0105245_112497301 | 3300009098 | Miscanthus Rhizosphere | QEAGERYAETGGDDLLIRLEPGELRAWDFADDFA* |
Ga0066709_1001074591 | 3300009137 | Grasslands Soil | STPADRSIIRRIATRYLGPEAGDRCAEGGGDDLLIRLEPGELRAWDFADDFG* |
Ga0116218_11310861 | 3300009522 | Peatlands Soil | GREAGAAYADSATDDLLIRLEPGELRAWDFADQLS* |
Ga0105249_111118973 | 3300009553 | Switchgrass Rhizosphere | RYLGVEEGEKYVSEGYDDTLIRLEPGRLRAWDFVDDM* |
Ga0105249_112690371 | 3300009553 | Switchgrass Rhizosphere | VVREIAGRYLGDEEGRAYADGGHDDTLIRLEPGRLRAWDFADDL* |
Ga0126374_111049801 | 3300009792 | Tropical Forest Soil | RYLGPEAGGQYADSAGDDLLIRLEPGELRAWDFADDIA* |
Ga0126374_114294651 | 3300009792 | Tropical Forest Soil | LGPEGGEQYAETAGDDLLIRLEPGELRAWDFADEFA* |
Ga0126309_111938542 | 3300010039 | Serpentine Soil | ADADDVYEIAGRYLGDEEGAAYADRGHDDTLIRLEPGRLRAWDFTDDL* |
Ga0134086_100399731 | 3300010323 | Grasslands Soil | PEAGEQYAETEGDDLLIRLEPGELRAWDFADDFV* |
Ga0134080_105560731 | 3300010333 | Grasslands Soil | SAGLSTLEDRSIVRRIATRYLGPEAGEQYAETTGGDDLLIRLEPGELRGWDFADDFA* |
Ga0134062_104195102 | 3300010337 | Grasslands Soil | RYLGGEEGEAYADRGDDDTLIRLEPGRLRAWDFADDL* |
Ga0126370_123383912 | 3300010358 | Tropical Forest Soil | YLGEDEGDAYTEMGEDDTLIRLEPGRLRAWDFADDL* |
Ga0126376_112813992 | 3300010359 | Tropical Forest Soil | YLGRETGGAYAGRAADDLLIRLEPGDLRAWDFADELA* |
Ga0126378_103421571 | 3300010361 | Tropical Forest Soil | GAEAGAAYAESAGDDLLIRLEPGNLRAWDFADEFS* |
Ga0126379_120770802 | 3300010366 | Tropical Forest Soil | AEAGSAYAERGGDDLLIQLEPGDLRGWDFADDFS* |
Ga0105239_122018342 | 3300010375 | Corn Rhizosphere | PVDGPAMVARIAGRYLGPQAGGRYAESGNDDLLIRIEPGELRGWDFTDDFD* |
Ga0134122_115273832 | 3300010400 | Terrestrial Soil | SRYLGAEGGATYVEEGGDDLVLRLEPGILRTWDFADDLS* |
Ga0134121_105913501 | 3300010401 | Terrestrial Soil | LSTPDDRSIVRRIATRYLGPEADEQYAESGGDDLLIRLEPGELRAWDFADDFT* |
Ga0134121_112429962 | 3300010401 | Terrestrial Soil | ARYLGQEGAAAYVESGGDDLLVRLEPGVLRTWDFADD* |
Ga0126350_114004021 | 3300010880 | Boreal Forest Soil | AVRYLGVEAGEAYVADFSDDVVIRLEPGTVRAWDFADEYT* |
Ga0137393_100598351 | 3300011271 | Vadose Zone Soil | VAVRYLGPELGPAYVEGGGDSLLIRLEPGDLRAWDFAEKLGEIERS* |
Ga0137364_108161762 | 3300012198 | Vadose Zone Soil | RKGGDRYTASAGDDLLIRLEPGELRAWDFADDFA* |
Ga0137365_105883201 | 3300012201 | Vadose Zone Soil | ATRYLGPEAGERYAETSGDDQLIRLEPGELRGWDFADDFS* |
Ga0137374_111612281 | 3300012204 | Vadose Zone Soil | RYLGERAGAAYAQTAGDDTVIRLEPGRLRAWDFSDEAPL* |
Ga0137381_104221103 | 3300012207 | Vadose Zone Soil | PGAGVAYAERVGDDLLIRLEPGDLRAWDFAGELT* |
Ga0137386_111144301 | 3300012351 | Vadose Zone Soil | IATRYLGEEAGAAYAERMRDDVVVRLEPGRFRAWDFSDEGV* |
Ga0137369_101198911 | 3300012355 | Vadose Zone Soil | RDGTAYAESAGDDTLIRLAPGRLRAWDFSDEYLA* |
Ga0137368_107802301 | 3300012358 | Vadose Zone Soil | IAVRYLGAEEGEAYVASAGDDTLIRLEPGHVRAWDFADDL* |
Ga0157313_10148942 | 3300012503 | Arabidopsis Rhizosphere | RYLGPEAGEQYAEGGGDDLLVRLEPGELRAWDFADDFA* |
Ga0157303_100075361 | 3300012896 | Soil | ARYLGPEFGEQYAETDADDLLIRLEPGELRGWDFADDFA* |
Ga0157293_100117744 | 3300012898 | Soil | VRYLGVEEGEKYVSEGYDDTLIRLEPGHLRAWDFVDDM* |
Ga0157301_102055152 | 3300012911 | Soil | RYLGPQAAAEYAESGGDDVIVRLEPGHLRAWDFADSVD* |
Ga0164304_116828572 | 3300012986 | Soil | ADADFVRDIAVRYLGDDQGQAYVDRGYDDTLIRLEPGHLRAWDFTDDF* |
Ga0157375_128451012 | 3300013308 | Miscanthus Rhizosphere | VVARVAGRYLGGEEGEQYAQTSGDDLLIRLEPGNLRAWDFADFYS* |
Ga0134079_103849983 | 3300014166 | Grasslands Soil | EEAGNAIRHIAVRYLGERDGVAYADSAGDDTLIRLEPGRLRAWDFADQL* |
Ga0173480_106991812 | 3300015200 | Soil | MSVPVLDIATRYLGAEKGRAYVDKGYDDTLIRLEPEYLRAWDFKDDPEL* |
Ga0187816_104379142 | 3300017995 | Freshwater Sediment | LRRGEVAYASRSMSLLLIRLEPGDLRAWDFADELS |
Ga0187815_104870002 | 3300018001 | Freshwater Sediment | YLGVEQGEAYAAGAGDDTLIRLEPGMLRAWDFADDY |
Ga0066667_111568331 | 3300018433 | Grasslands Soil | RRLATRCRGPEGGDQYAQGGGDDLLIRLEPDALRAWDFADEFA |
Ga0066669_114046251 | 3300018482 | Grasslands Soil | IAARYLGERDGAAYAASSGDDTLIRLEPGRLRAWDFADQL |
Ga0210399_102718982 | 3300020581 | Soil | SRYLGAEAGAAYAESAGDDLLIRVEPGELRAWDFADEFS |
Ga0210388_107310141 | 3300021181 | Soil | IASRYLGLEAGAAYADSADDDLLVRLEPGELRAWDFAGEHS |
Ga0210402_104375743 | 3300021478 | Soil | RYLGPRAGAAYADTARDDLLIRLEPGDLRAWDFADEYS |
Ga0247791_10933192 | 3300023062 | Soil | GAEVAAAYVRSLTGNDLLVRVEPGELRVWDFADDFPSG |
Ga0207656_102937762 | 3300025321 | Corn Rhizosphere | ERSIVGRIAARYLGSEAGEQYAETAGDDVLIRLEPGTLRGWDFADYFAC |
Ga0207685_104521562 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | IRYLGETEGAAQAERLADDVVLRLEPGDLRAWDFTDEY |
Ga0207685_107737991 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | DGSVVSRIAGRYLGREAGERYAETAGDDLLIRLEPGDLRAWDFSDYFT |
Ga0207699_111568981 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRIAARYLGQEAGERYAESAGDDLLIRLEPGQLRAWDFSDYFA |
Ga0207644_106355711 | 3300025931 | Switchgrass Rhizosphere | RYLGQEAGERYAETAGDDLLIRLEPGQLRAWDFADDFA |
Ga0207709_118263492 | 3300025935 | Miscanthus Rhizosphere | ARYLGPEFGEQYAETDADDLLIRLEPGELRGWDFADDFA |
Ga0207675_1004238551 | 3300026118 | Switchgrass Rhizosphere | LGDEEGRAYADGGHDDTLIRLEPGRLRAWDFADDL |
Ga0207675_1004570031 | 3300026118 | Switchgrass Rhizosphere | RYLGPDEGQRYDETAGDDLLIRLEPGELRGWDFADHFAG |
Ga0209795_101456522 | 3300027718 | Agave | VPEDRSIVRRIATRYLGPEAGEQYAEGAGDDLLIRLEPGELRGWDFADDFA |
Ga0209177_103193442 | 3300027775 | Agricultural Soil | ITLEERSIVGRIAARYLGSEAGEQYAETAGDDVLIRLEPGTLRGWDFADYFAC |
Ga0307291_10087033 | 3300028707 | Soil | RDIAGRYLGDEEGGAYADRGYDDTLIRLEPGRLRAWDFADDL |
Ga0307311_102084501 | 3300028716 | Soil | ADVVRDIAGRYLGDEEGGAYADRGYDDTLIRLEPGRLRAWDFADDL |
Ga0307297_103771362 | 3300028754 | Soil | RDIAVRYLGDEEGGAYADRGYDDTLIRLEPGRLRAWDFADDL |
Ga0307316_103023301 | 3300028755 | Soil | SRYLGAEAGAAYAEQTTDDTIIRLEPGRLRAWDFSDEAT |
Ga0307323_100044187 | 3300028787 | Soil | RYLGDEEGGAYADRGYDDTLIRLEPGRLRAWDFADDL |
Ga0307305_103893832 | 3300028807 | Soil | RYLGREKGTAYAAEEADDVLIRLEPGRLRAWDFADEYPTTET |
Ga0307278_105321632 | 3300028878 | Soil | ATRYLGPDEGERYGEVGVDDLLIRLEPGELRAWDFADYFA |
Ga0307469_122274641 | 3300031720 | Hardwood Forest Soil | LGPEEGERYVESGNDDLLIRLEPGELRAWDFVDSFA |
Ga0306918_101935081 | 3300031744 | Soil | VGDAVLRIASHYLGPEAGAAYADSAGDDLLIRLEPGRLRAWDFADELA |
Ga0318546_104992311 | 3300031771 | Soil | IASRYLGPEAGAAYAERGNDDLLIRLEPGDLRAWDFADDL |
Ga0306919_110136072 | 3300031879 | Soil | SRYLGPEAGAAYAERGYDDLLIRLEPGDLRAWDFADDL |
Ga0306921_119552371 | 3300031912 | Soil | VTRIASRYLGPEAGAAYAERGNDDLLIRLEPGDLRAWDFADDL |
Ga0308175_1017550992 | 3300031938 | Soil | TTARLSTLEDRSVVARIAARYLGREAGDRYAETAGDDLLIRLEPGDVRAWDFSDTYA |
Ga0308174_104792302 | 3300031939 | Soil | RIAARYLGREAGDRYAETAGDDLLIRLEPGDVRAWDFSDSYA |
Ga0318504_102119442 | 3300032063 | Soil | YLGPEAGAAYADSAGDDLLIRLEPGRLRAWDFADELA |
Ga0310895_105824081 | 3300032122 | Soil | IAGRYLGDEEGRAYADGGHDDTLIRLEPGRLRAWDFADDL |
Ga0307472_1010932043 | 3300032205 | Hardwood Forest Soil | RAIAIRYLGEEAGTAYAEQIADETLIRLEAGRVRAWDFADEYS |
Ga0335078_101092211 | 3300032805 | Soil | ITSRYLGRQAGAAYAGSAADDLLIRLEPGDLRAWDFAGEPS |
Ga0335081_116429901 | 3300032892 | Soil | GGADAIVAIASRYLGPEEGRAYADSASDDTLIRLEPGTIRAWDFSDE |
Ga0335083_109079802 | 3300032954 | Soil | YLGRQAGAAYADSGLDDLLIRLEPGELRAWDFADQLS |
⦗Top⦘ |