| Basic Information | |
|---|---|
| Family ID | F102067 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VGSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAMIFG |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (54.902 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.176 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.196 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.50% β-sheet: 5.00% Coil/Unstructured: 72.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF13759 | 2OG-FeII_Oxy_5 | 0.98 |
| PF13385 | Laminin_G_3 | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 54.90% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 15.69% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.78% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.92% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.94% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.98% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.98% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.98% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.98% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023296 | Saline water microbial communities from Ace Lake, Antarctica - #604 | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24006J15134_100506291 | 3300001450 | Marine | AAVGSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAMIFG* |
| JGI24003J15210_101671071 | 3300001460 | Marine | SYTVTLPAAVGSASQALVTSDGSGNTQWTSTSSFGITTGKAIAMAIVFG* |
| JGI24005J15628_102006471 | 3300001589 | Marine | LPAAVGSASQALVTTDGSGTLGFTSTSTFGITTGKAIAMAIVFG* |
| JGI24523J20078_10348262 | 3300001718 | Marine | VGSASQALVTTDGSGTLGFTSTSSFGISTGKAIAMAIVFG* |
| JGI25132J35274_10489403 | 3300002483 | Marine | PAAVGSASQALVTTDGSGTLGFTSTSTFGISTGKAIAMAIVFG* |
| JGI25131J35506_10457752 | 3300002511 | Marine | LPAAVGAAADYALTTSDGSGNTQWTATSTFGITTGKAIAMAMIFG* |
| JGI25134J35505_100934853 | 3300002518 | Marine | GAAADYALTTSDGSGNTQWTATSTFGITTGKAIAMAIVFG* |
| Ga0055584_1015501771 | 3300004097 | Pelagic Marine | VGSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAMIFG* |
| Ga0066856_102687733 | 3300005404 | Marine | PAAVGSASQALVTSDGSGNTQWTSTSTFGITTGKAIAMAIVFG* |
| Ga0098035_11679211 | 3300006738 | Marine | DYALTTSDGSGNTQWTATSTFGITTGKAIAMAMIFG* |
| Ga0098035_13052752 | 3300006738 | Marine | YTLTLPAAVGAAADYALTTSDGSGNTQWTATSTFGITTGKAIAMAMIFG* |
| Ga0098058_11298051 | 3300006750 | Marine | VGAAADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0098048_11560631 | 3300006752 | Marine | ITLPAAVAGGADYALTTTDGAGTTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0098048_11777541 | 3300006752 | Marine | SQVLVTTDGAGTLGFTSLPSAGISTGKAIAMAIVFG* |
| Ga0098044_12062821 | 3300006754 | Marine | PAAVGAAADYALTTSDGSGNTQWTATSTFGITTGKAIAMALVFG* |
| Ga0075475_102518191 | 3300006874 | Aqueous | SASQALVTSDGSGNTQWTSTSTFGITTGKAIAMAIVFG* |
| Ga0070748_12090881 | 3300006920 | Aqueous | TAVAGAADYALTTTDAAGNTQWVATSTFGISTGKAIAMAIVFG* |
| Ga0098060_10152465 | 3300006921 | Marine | AAVGSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAIVFG* |
| Ga0098053_10591311 | 3300006923 | Marine | YALTTTDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0098053_10754362 | 3300006923 | Marine | VGAAADYALTTSDGSGNTQWTATSTFGITTGKAIAMAMIFG* |
| Ga0098051_10770961 | 3300006924 | Marine | DAVAGGADYALTTTDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0098050_10453131 | 3300006925 | Marine | AVGAAADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0098034_11761782 | 3300006927 | Marine | LPAAVGAAADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0098041_12567692 | 3300006928 | Marine | VGSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAIVFG* |
| Ga0098046_11324402 | 3300006990 | Marine | AAVAGGADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0075468_101952232 | 3300007229 | Aqueous | SQALVTTDGSGTLGFTSTSSFGISTGKAIAMAIVFG* |
| Ga0075460_100458964 | 3300007234 | Aqueous | PTAVAAGANYALTTTDASGNTQWTATSTFGISTGKAIAMAIVFG* |
| Ga0075460_102522691 | 3300007234 | Aqueous | VGSASQALVTTDGAGTLGFTSTSSFGITTGKAIAMAMIFG* |
| Ga0075460_102799681 | 3300007234 | Aqueous | PTAVAAGANYALTTTDASGNTQWTATSTFGISTGKAIAMALVFG* |
| Ga0070747_11637943 | 3300007276 | Aqueous | YTITLPTAVAGSANFALTTTDGSGNTQWVSTSTFGISTGKAIAMAMIFG* |
| Ga0099849_12402533 | 3300007539 | Aqueous | QALVTTDGSGTLGFTSTSTFGITTGKAIAMAIVFG* |
| Ga0099847_11287503 | 3300007540 | Aqueous | VAAGANYALTTTDASGNTQWTDTSTFGISTGKAIAMAIVFG* |
| Ga0110931_10797123 | 3300007963 | Marine | AAVGSASQALVTSDGSGNTQWTSTSTFGISTGKAIAMAIVFG* |
| Ga0098052_12232443 | 3300008050 | Marine | YALTTTDGAGTTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0098052_12560393 | 3300008050 | Marine | DYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0115551_13687501 | 3300009193 | Pelagic Marine | GSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAMIFG* |
| Ga0114994_110796902 | 3300009420 | Marine | TLPAAVGSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAMIFG* |
| Ga0115555_14392412 | 3300009476 | Pelagic Marine | ASQALVTSDGSGNTQWTSTSTFGISTGKAIAMAIVFG* |
| Ga0115567_106425301 | 3300009508 | Pelagic Marine | GSASQALVTSDGSGNTQWTSTSTFGITTGKAIAMAMIFG* |
| Ga0115011_100837454 | 3300009593 | Marine | ADYALTSTDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0115104_112696181 | 3300009677 | Marine | QALVTTDGAGTLGFTSTSSFGISTGKAIAMAIVFG* |
| Ga0115001_104182313 | 3300009785 | Marine | LPAAVGASSTALVTTDASGTLGWTATSTFGITTGKAIAMAMIFG* |
| Ga0098049_11744601 | 3300010149 | Marine | ITLPAAVASGADYALTTSDSAGTMQWTATSTFGISIGKSIAMAMIFG* |
| Ga0098056_10995061 | 3300010150 | Marine | TLTLPAAVGAAADYALTTTDGSGNTQWTATSTFGISTGKAIAMAIVFG* |
| Ga0098061_12022891 | 3300010151 | Marine | AAVGSTSQALVTTDGSGTLGFTSTSSFGISTGKAIAMAIVFG* |
| Ga0098061_12398973 | 3300010151 | Marine | GAAADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0098059_12544791 | 3300010153 | Marine | LTLPAAVGAAADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG* |
| Ga0133547_119295031 | 3300010883 | Marine | AVGASSTALVTTDASGTLGWTATSTFGITTGKAIAMAMIFG* |
| Ga0160422_108193481 | 3300012919 | Seawater | YTLTLPAAVGAAADYALTTSDGSGNTQWTATSTFGISTGKAIAMAIVFG* |
| Ga0160423_103120791 | 3300012920 | Surface Seawater | AADYALTTSDGSGNTQWTATSTFGITTGKAIAMAIVFG* |
| Ga0163180_119315491 | 3300012952 | Seawater | PAAVGASSTALVTTDGSGTLGWTATSSFGITTGKAIAMAIVFG* |
| Ga0181391_10174933 | 3300017713 | Seawater | SQALVTTDGAGTLGFTSTSTFGISTGKAIAMAMVFG |
| Ga0181375_10465581 | 3300017718 | Marine | VGAAADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0181390_10787971 | 3300017719 | Seawater | TLPAAVGSASQALVTTDGAGTLGFTSTSTFGITTGKAIAMAIVFG |
| Ga0181398_10831483 | 3300017725 | Seawater | DYALTTTDGSGNTQWVATSTFGISTGKAIAMAMIFG |
| Ga0181389_10175893 | 3300017746 | Seawater | ASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAMIFG |
| Ga0181392_10199261 | 3300017749 | Seawater | SQALVTTDGSGTLGFTSTSSFGISTGKAIAMAIVFG |
| Ga0181411_10634001 | 3300017755 | Seawater | SQALVTTDGAGTLGFTSTSSFGITTGKAIAMAIVFG |
| Ga0181409_10573633 | 3300017758 | Seawater | PAAVGSASQALVTTDGAGTLGFTSTSSFGISTGKAIAMAIVFG |
| Ga0181410_10320821 | 3300017763 | Seawater | ASQALVTTDGAGTLGFTSTSSFGISTGKAIAMAIVFG |
| Ga0181410_11505083 | 3300017763 | Seawater | ASQALVTTDGAGTLGFTSTSSFGISTGKAIAMAMIFG |
| Ga0181430_12244461 | 3300017772 | Seawater | EKPAAVGASGTALVTTDASGTLGFTATSTFGITTGKAIAMAMIFG |
| Ga0181424_100510383 | 3300017786 | Seawater | TLPAAVGSASQALVTSDGSGNTQWTSTSTFGISTGKAIAMAIVFG |
| Ga0211678_101922611 | 3300020388 | Marine | QVLVTTDGSGTLGFTSTSSFGITTGKAIAMAMIFG |
| Ga0211577_106525951 | 3300020469 | Marine | QALVTTDGAGTLGFTSTSSFGISTGKAIAMAIVFG |
| Ga0196899_10774581 | 3300022187 | Aqueous | STGQVIQTDGAGNLSFVTSSGISTGKAIAMAIVFG |
| Ga0196899_11215073 | 3300022187 | Aqueous | DYALTTTDAAGNTQWVATSTFGISTGKAIAMAIVFG |
| Ga0196901_11156343 | 3300022200 | Aqueous | AVGSASQALVTTDGSGTLGFTSTSSFGISTGKAIAMAIVFG |
| Ga0222664_10145484 | 3300023296 | Saline Water | DYALTTTDAAGNTQWVATSTFGITTGKAIAMAMIFG |
| (restricted) Ga0255050_101718052 | 3300024052 | Seawater | VAGGADYALTSSDGSGNTQWTATSTFGITTGKAIAMAMIFG |
| Ga0207902_10322483 | 3300025046 | Marine | AADYALTTSDGAGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0207905_10121081 | 3300025048 | Marine | PAAVGSASQALVTTDGSGTLGFTSTSSFGISTGKAIAMAIVFG |
| Ga0207905_10325171 | 3300025048 | Marine | YTMTLPAAVGASGTALVTTDASGTLGFTATSTFGISTGKAIAMAMIFG |
| Ga0207887_10305301 | 3300025069 | Marine | GAAADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0207887_10765132 | 3300025069 | Marine | DYALTTSDGAGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0207896_10027383 | 3300025071 | Marine | VGSASQALVTTDGSGTLGFTSTSSFGISTGKAIAMAIVFG |
| Ga0208792_10266621 | 3300025085 | Marine | AVGAAADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0208011_11113371 | 3300025096 | Marine | AADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0208434_10363551 | 3300025098 | Marine | GADYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0208669_10801313 | 3300025099 | Marine | TLTLPAAVGSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAIVFG |
| Ga0208793_10614973 | 3300025108 | Marine | VAGGADYALTTTDGAGTTQWTATSTFGISTGKAIAMAMIFG |
| Ga0209644_10225241 | 3300025125 | Marine | YALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0208919_12048222 | 3300025128 | Marine | LTLPAAVGSASQALVTTDGAGTLGFTSTSSFGITTGKAIAMAIVFG |
| Ga0209232_11278943 | 3300025132 | Marine | GSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAIVFG |
| Ga0208299_10883861 | 3300025133 | Marine | DYALTTSDGSGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0209337_10104031 | 3300025168 | Marine | AAVGSASQALVTTDGAGTLGFTSTSTFGISTGKAIAMAMIFG |
| Ga0208643_11359371 | 3300025645 | Aqueous | TLPTAVAGSANFALTTTDGSGNTQWVSTSTFGITTGKAIAMAMIFG |
| Ga0208542_11747881 | 3300025818 | Aqueous | VGSASQALVTTDGAGTLGFTSTSSFGITTGKAIAMAMIFG |
| Ga0209757_103085401 | 3300025873 | Marine | TITLPAAVGAAADYALTTSDGAGNTQWTATSTFGISTGKAIAMAMIFG |
| Ga0208644_11013121 | 3300025889 | Aqueous | ANFALTTTDGSGNTQWVATSTFGITTGKAIAMAMIFG |
| Ga0209710_12535271 | 3300027687 | Marine | SYTITLPTAVAGAADYALTTTDAAGNTQWVATSTFGISTGKAIAMAMIFG |
| Ga0209192_102063003 | 3300027752 | Marine | AVGASSTALVTTDASGTLGWTATSTFGITTGKAIAMAMIFG |
| Ga0209502_103635362 | 3300027780 | Marine | TITLPTAVAGAADYALTTTDAAGNTQWVATSTFGISTGKAIAMAMIFG |
| (restricted) Ga0255055_105048022 | 3300027881 | Seawater | ITLPTAVAGAADYALTTTDAAGNTQWVATSTFGITTGKAIAMAMIFG |
| Ga0256368_10545461 | 3300028125 | Sea-Ice Brine | LPAAVGSASQALVTTDGSGTLGFTSTSSFGISTGKAIAMAIVFG |
| Ga0183757_10593333 | 3300029787 | Marine | TALVTTDGSGTLGFTATSTFGITTGKAIAMAIVFG |
| Ga0307488_100407681 | 3300031519 | Sackhole Brine | AAVGASSTALVTTDASGTLGWTATSTFGITTGKAIAMAMIFG |
| Ga0307488_100949623 | 3300031519 | Sackhole Brine | VASAADYALTTTDAAGNTQWVATSTFGITTGKAIAMAMIFG |
| Ga0307488_103938011 | 3300031519 | Sackhole Brine | GVGSASQALVTTDGSGTLGFTSTSSFGISTGKAIAMAIVFG |
| Ga0302118_105006921 | 3300031627 | Marine | VGASSTALVTTDASGTLGWTATSTFGITTGKAIAMAMIFG |
| Ga0315315_101206643 | 3300032073 | Seawater | QALVTTDGSGTLGFTSTSSFGITTGKAIAMAIVFG |
| Ga0348337_163662_3_116 | 3300034418 | Aqueous | ASQALVTTDGAGTLGFTSTSSFGITTGKAIAMAIVFG |
| ⦗Top⦘ |