| Basic Information | |
|---|---|
| Family ID | F102063 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | PYIKADTIAQANRIAIQYGLLVLGEIQELEHDDQTKKRTVH |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.20 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (74.510 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (25.490 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.490 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.196 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF03237 | Terminase_6N | 8.82 |
| PF04607 | RelA_SpoT | 0.98 |
| PF01592 | NifU_N | 0.98 |
| PF11651 | P22_CoatProtein | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 74.51 % |
| All Organisms | root | All Organisms | 24.51 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 25.49% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 14.71% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.73% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.88% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.90% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.90% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.90% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.92% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.94% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.96% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.96% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.98% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.98% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.98% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.98% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
| 3300009543 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022158 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022369 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024243 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_150_MG | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027234 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027572 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_08_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100316061 | 3300000116 | Marine | AIGPYIKAHTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH* |
| DelMOSpr2010_102106213 | 3300000116 | Marine | GPYIKAETVGEANRIAIQYGLLVLGEIQELQHENIETKRTVH* |
| DelMOSpr2010_102464633 | 3300000116 | Marine | AIGPYIKAHTVAEANRIAIQYGLLVLGEIQELEHETELKKKVVH* |
| DelMOWin2010_101245935 | 3300000117 | Marine | GAAIGPYIKADTVAEANRIAIQYGLLVLGEIQELQHDTKVKERTLH* |
| DelMOWin2010_102473453 | 3300000117 | Marine | IGPYIKADTIAQANRIAIQYGLLVLGEIQELEHDDHTRKRTVH* |
| JGI24006J15134_100677641 | 3300001450 | Marine | GPYIKADTVAQANRIAIQYGLLVLGEIQELEYSNEEEKRIVH* |
| JGI11772J19994_10257251 | 3300001748 | Saline Water And Sediment | YIKAETVAEANRIAIQYGLLVLGEIQELQHDTTIKKTIH* |
| GOS2237_10537101 | 3300001955 | Marine | AAIGPYIKAETVAEANRIAIQYGLLVLGEIQELQHDTTVKKRTVH* |
| JGI25132J35274_10973711 | 3300002483 | Marine | AIGPYIKADTVAEANRIAIQYGLLVLGEIQELQHDTTVKKRTVH* |
| Ga0068515_1063037 | 3300004829 | Marine Water | AIGPYIKADTVAEANRIAIQYGLLVLGEIQELQHEVKLEERKLH* |
| Ga0068515_1184441 | 3300004829 | Marine Water | IGPYIKAETVAEANRIAIQYGLLVLGEIQELQHDTTVKKRTVH* |
| Ga0075474_102124191 | 3300006025 | Aqueous | GAAIGPYIKADTIAQANRIAIQYGLLVLGEIQELEHEVELKKKVVH* |
| Ga0075478_102393013 | 3300006026 | Aqueous | AIGPYIKADTIAQANRIAIQYGLLVLGEIQELEHDDHTRKRTVH* |
| Ga0075462_101413174 | 3300006027 | Aqueous | IKADTVAEANRIAIQYGLLVLGEIQELQHDTTVKKRTVH* |
| Ga0098048_10610135 | 3300006752 | Marine | IKADTIAQANRIAIQYGLLVLGEIQELEHDDQTKKRTIH* |
| Ga0098048_12256731 | 3300006752 | Marine | KADTIAQANRIAIQYGLLVLGEIQELEHDDQTKKRTVH* |
| Ga0098048_12511231 | 3300006752 | Marine | IKADTIAQASRIAIQYGLLVLGEIQELQHNEQELKKVVH* |
| Ga0075467_102800071 | 3300006803 | Aqueous | TDQGASIGPYIKADTIAQANRIAIQYGLLVLGEIQELEHEVELKERTVH* |
| Ga0070754_105047972 | 3300006810 | Aqueous | GPYIKAETVGEANRIAIQYGLLVLGEIQELQHDTTVKKRTLH* |
| Ga0075476_103300101 | 3300006867 | Aqueous | ETVAEANRIAIQYGLLVLGEIQELQHDIQLEERKVH* |
| Ga0075479_103877891 | 3300006870 | Aqueous | IGPYIKADTIAQANRIAIQYGLLVLGEIQELEHEVELKKKVVH* |
| Ga0075475_103702171 | 3300006874 | Aqueous | GAAIGPYIKADTIAQANRIAIQYGLLVLGEIQELEHEVELEKKLVH* |
| Ga0070750_102337974 | 3300006916 | Aqueous | GIGLGPYIKAETVGEANRIAIQYGLLVLGEIQELQHEVKLEKRVVH* |
| Ga0098050_10930621 | 3300006925 | Marine | SIGPYIKADTIAKASRIAIQYGLLVLGEIQELQHNEQELKKVVH* |
| Ga0098050_11247361 | 3300006925 | Marine | TIAQASRIAIQYGLLVLGEIQELQHNEQELKKVVH* |
| Ga0075468_102176181 | 3300007229 | Aqueous | NEDGAAIGPYIKADTIAQANRIAIQYGLLVLGEIQELEHDDQTKKRTVH* |
| Ga0070752_10593711 | 3300007345 | Aqueous | IKADTVAQANRIAIQYGLLVLGEIQELEHEVELEKKLVH* |
| Ga0070752_13130421 | 3300007345 | Aqueous | KAETVGEANRIAIQYGLLVLGEIQELQHDTTVKKRTLH* |
| Ga0070752_13287081 | 3300007345 | Aqueous | ADTIAQASRIAIQYGLLVLGEIQELQHNEQELKKVVH* |
| Ga0070753_10954841 | 3300007346 | Aqueous | IGPYIKADTIAKASRIAIQYGLLVLGEIQELQHEEQEIKKIVH* |
| Ga0070753_13205301 | 3300007346 | Aqueous | PYIKAETVAEANRIAIQYGLLVLGEIQELQHDTTVKKRTLH* |
| Ga0075480_104548173 | 3300008012 | Aqueous | PYIKAETVGEANRIAIQYGLLVLGEIQELQHDTTVKKRTLH* |
| Ga0102892_10832951 | 3300009057 | Estuarine | DTIAQASRIAIQYGLLVLGEIQELQHEEQEIKRLVH* |
| Ga0115099_109331961 | 3300009543 | Marine | EGSAIGPYIKADTIAQANRIAIQYGLLVLGEIQELQHDIQLEERKVH* |
| Ga0115103_11214671 | 3300009599 | Marine | AHTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH* |
| Ga0115103_18533361 | 3300009599 | Marine | IGPYIKAHTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRTVH* |
| Ga0136656_12233973 | 3300010318 | Freshwater To Marine Saline Gradient | VGEANRIAIQYGLLVLGEIQELQHDTTVKKRVVH* |
| Ga0129324_102716053 | 3300010368 | Freshwater To Marine Saline Gradient | YIKAETVGEANRIAIQYGLLVLGEIQELQHEVKLEKKTVH* |
| Ga0129344_11223722 | 3300012520 | Aqueous | LGPYIKADTVAEANRIAIQYGLLVLGEIQELQHDTTVKKRVVH* |
| Ga0181377_10926791 | 3300017706 | Marine | YIKADTIAQANRIAIQYGLLVLGEIQELEHDDQTKKRTIH |
| Ga0181391_11335823 | 3300017713 | Seawater | AHTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH |
| Ga0181404_10440665 | 3300017717 | Seawater | GPYIKANTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRTVH |
| Ga0181390_10841444 | 3300017719 | Seawater | EGIAIGPYIKADTIAQASRIAIQYGLLVLGEIQELQHEEQEIKKIVH |
| Ga0181419_11726623 | 3300017728 | Seawater | PYIKADTIAQANRIAIQYGLLVLGEIQELQHDTQLEKRIVH |
| Ga0181431_10353131 | 3300017735 | Seawater | NTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH |
| Ga0181402_11684463 | 3300017743 | Seawater | IKADTIAQANRIAIKYGLLVLGEIQELEQDDQTKKRTVH |
| Ga0181392_10139881 | 3300017749 | Seawater | YIKADTVAQANRIAIQYGLLVLGEIQELEHEVELEKKVVH |
| Ga0181400_10740581 | 3300017752 | Seawater | ADTVAQANRIAIQYGLLVLGEIQELEHEIELEKKLVH |
| Ga0181407_10180341 | 3300017753 | Seawater | TVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH |
| Ga0181414_11811071 | 3300017759 | Seawater | DGAAIGPYIKADTIAQANRIAIQYGLLVLGEIQELEHDDQTKKRTVH |
| Ga0181386_11340761 | 3300017773 | Seawater | AIGPYIKADTIAQASRIAIQYGLLVLGEIQELQHEEQEIKKIVH |
| Ga0181386_12116133 | 3300017773 | Seawater | AIGPYIKADTIAQASRIAIQYGLLVLGEIQELQHEEQEIKRLVH |
| Ga0181394_12716271 | 3300017776 | Seawater | YIKADTIAQANRIAIQYGLLVLGEIQELQHDIQLEERKVH |
| Ga0181423_10988071 | 3300017781 | Seawater | KANTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRTVH |
| Ga0181379_11016891 | 3300017783 | Seawater | ANTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH |
| Ga0194023_11261672 | 3300019756 | Freshwater | IKANTVAEANRIAIQYGLLVLGEIQELEHEVKIKERTVH |
| Ga0181575_100242928 | 3300020055 | Salt Marsh | TSLGPYIKAETVGEANRIAIQYGLLVLGEIQELQHDIQLEERTVH |
| Ga0206131_102121741 | 3300020185 | Seawater | SSIGPYIKADTVAQANRIAIQYGLLVLGEIQELQHDEPIQKRMIH |
| Ga0206677_100533961 | 3300021085 | Seawater | IGPYIKANTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH |
| Ga0206677_101508521 | 3300021085 | Seawater | GAAIGPYIKADTVAEANRIAIQYGLLVLGEIQELQHDIQLEERKVH |
| Ga0206682_100767551 | 3300021185 | Seawater | KANTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH |
| Ga0213860_101489545 | 3300021368 | Seawater | KADTIAQASRIAIQYGLLVLGEIQELQHNEQELKKVVH |
| Ga0213865_104506801 | 3300021373 | Seawater | DAHEGVAIGPYIKADTIAQASRIAIQYGLLVLGEIQELQHNEQELKKVIH |
| Ga0213868_106040783 | 3300021389 | Seawater | YIKADTVAEANRIAIQYGLLVLGEIQELQHDTKVKERTLH |
| Ga0213866_100598237 | 3300021425 | Seawater | ADTIAQASRIAIQYGLLVLGEIQELQHNEQELKKVIH |
| Ga0213866_100779518 | 3300021425 | Seawater | GTGIGPYIKANTVAEANRIAIQYGLLVLGEIHELEHEVKLEERKVH |
| Ga0222717_106213333 | 3300021957 | Estuarine Water | ADTIAQASRIAIQYGLLVLGEIQELQHEEQEIKRLVH |
| Ga0222717_106426383 | 3300021957 | Estuarine Water | IKADTIAQANRIAIQYGLLVLGEIQELQHDTQLEERKVH |
| Ga0222716_100533527 | 3300021959 | Estuarine Water | YIKAHTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRTVH |
| Ga0222716_101902976 | 3300021959 | Estuarine Water | GIAIGPYIKADTIAQASRIAIQYGLLVLGEIQELQHEEQEIKRLVH |
| Ga0222716_104283324 | 3300021959 | Estuarine Water | GIAIGPYIKADTIAQASRIAIQYGLLVLGEIQELQHEEQEIKKIVH |
| Ga0222716_106268443 | 3300021959 | Estuarine Water | PYIKADTIAQANRIAIQYGLLVLGEIQELEHDDQTKKRTVH |
| Ga0196895_10219551 | 3300022067 | Aqueous | PYIKADTVGEANRIAIQYGLLVLGEIQELQHDTKVKERTLH |
| Ga0212028_10632293 | 3300022071 | Aqueous | TYIKAETVAEANRIAIQYGLLVLGEIQELQHDTTIKKKTIH |
| Ga0196897_10182575 | 3300022158 | Aqueous | YIKAETVGEANRIAIQYGLLVLGEIQELQHDTTIKKKTIH |
| Ga0196901_12658561 | 3300022200 | Aqueous | NTVAEANRIAIQYGLLVLGEIHELEHEVKLEKKMVH |
| Ga0210310_10372353 | 3300022369 | Estuarine | EGSAIGPYIKADTIAQANRIAIQYGLMVLGEIQELQHDDSQQKRIVH |
| Ga0255782_100985891 | 3300023105 | Salt Marsh | TLGPYIKAETVGEANRIAIQYGLLVLGEIQELQHDIQLEEKVVH |
| Ga0255759_108129662 | 3300023178 | Salt Marsh | TIAEANRIAIQYGLLVLGEIQELQHDTKVKERVVH |
| (restricted) Ga0233412_104180203 | 3300023210 | Seawater | EDGAAIGPYIKAHTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH |
| (restricted) Ga0233436_12234163 | 3300024243 | Seawater | KADTIAQANRIAIQYGLMVLGEIQELQHDDSQQKRIVH |
| Ga0207890_10092458 | 3300025079 | Marine | GPYIKADTVAQANRIAIQYGLLVLGEIQELEYSNEEEKRIVH |
| Ga0207890_10610931 | 3300025079 | Marine | DTVAQANRIAIQYGLLVLGEIQELEHEIKIEERVVH |
| Ga0209336_101131034 | 3300025137 | Marine | IGPYIKADNIAQANRIAIQYGLLVLGEIQELEHEIKIEERVVH |
| Ga0209336_101850923 | 3300025137 | Marine | IGPYIKADNIAQANRIAIQYGLLVLGEIQELEHEIKIEEKVVH |
| Ga0209645_12294272 | 3300025151 | Marine | KADTVAEANRIAIQYGLLVLGEIQELQHEVKLEKKVVH |
| Ga0208149_100162611 | 3300025610 | Aqueous | PYIKAETVAEANRIAIQYGLLVLGEIQELEHDDHTRKRTVH |
| Ga0208898_11832361 | 3300025671 | Aqueous | ETVAEANRIAIQYGLLVLGEIQELQHDTTIKKKTIH |
| Ga0208767_12484981 | 3300025769 | Aqueous | TVAEANRIAIQYGLLVLGEIQELEHDNQIKKRTVH |
| Ga0209666_13621552 | 3300025870 | Marine | GPYIKAETVGEANRIAIQYGLLVLGEIQELQHDTEVKERVVH |
| Ga0209929_11018544 | 3300026187 | Pond Water | TVAEANRIAIQYGLLVLGEIQELQHEVKLEERKVH |
| Ga0208170_10078501 | 3300027234 | Estuarine | IAIGPYIKADTIAQASRIAIQYGLLVLGEIQELQHEEQEIKRLVH |
| Ga0208964_10992921 | 3300027572 | Marine | PYIKAHTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRTVH |
| Ga0208304_101199401 | 3300027751 | Estuarine | AIGPYIKAHTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH |
| Ga0208671_103230351 | 3300027757 | Estuarine | IKADTVAEANRIAIQYGLLVLGEIQELEHEVKLKERTVH |
| Ga0257114_11793271 | 3300028196 | Marine | YIKAHTVAEANRIAIQYGLLVLGEIQELEHDDQTKKRIVH |
| Ga0183755_10084071 | 3300029448 | Marine | YIKADTVAQANRIAIQYGLLVLGEIQELEHEVELEKKLVH |
| Ga0302121_101939803 | 3300031626 | Marine | ETIAQANRIAIQYGLLVLGEIQELEYEVKLEERIVH |
| Ga0316201_104671111 | 3300032136 | Worm Burrow | YIKADTVGEANRIAIQYGLLVLGEIQELQHDTKVKERTLH |
| Ga0316202_104946261 | 3300032277 | Microbial Mat | IGPYIKADTIAQANRIAIQYGLLVLGEIQELEHDDQTKKRTVH |
| Ga0348335_127736_1_135 | 3300034374 | Aqueous | AIGPYIKADTIAQANRIAIQYGLLVLGEIQELEHEVELEKKLVH |
| Ga0348337_173440_455_574 | 3300034418 | Aqueous | IKADTIAQANRIAIQYGLLVLGEIQELEHEVELKKKVVH |
| ⦗Top⦘ |