| Basic Information | |
|---|---|
| Family ID | F102012 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNRAATLALVLLALPLAAPAKDLIGVFEDAVHNDPVIRQADANR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 94.12 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.25 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (65.686 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (42.157 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.235 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.039 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01135 | PCMT | 79.41 |
| PF08448 | PAS_4 | 10.78 |
| PF00672 | HAMP | 1.96 |
| PF01904 | DUF72 | 0.98 |
| PF13188 | PAS_8 | 0.98 |
| PF13426 | PAS_9 | 0.98 |
| PF03030 | H_PPase | 0.98 |
| PF00990 | GGDEF | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 79.41 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 79.41 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 79.41 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 79.41 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.98 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 65.69 % |
| All Organisms | root | All Organisms | 34.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10322445 | Not Available | 958 | Open in IMG/M |
| 3300005175|Ga0066673_10222301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1085 | Open in IMG/M |
| 3300005332|Ga0066388_103138576 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300005363|Ga0008090_10102522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1540 | Open in IMG/M |
| 3300005534|Ga0070735_10067401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2316 | Open in IMG/M |
| 3300005546|Ga0070696_101084438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 672 | Open in IMG/M |
| 3300005561|Ga0066699_10107973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1846 | Open in IMG/M |
| 3300005568|Ga0066703_10377707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 850 | Open in IMG/M |
| 3300005591|Ga0070761_10098487 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300005921|Ga0070766_10517918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 794 | Open in IMG/M |
| 3300006032|Ga0066696_10740501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 629 | Open in IMG/M |
| 3300006046|Ga0066652_101557502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 610 | Open in IMG/M |
| 3300009012|Ga0066710_103362382 | Not Available | 609 | Open in IMG/M |
| 3300009148|Ga0105243_10395762 | Not Available | 1282 | Open in IMG/M |
| 3300009551|Ga0105238_12489461 | Not Available | 553 | Open in IMG/M |
| 3300010048|Ga0126373_12805615 | Not Available | 544 | Open in IMG/M |
| 3300010159|Ga0099796_10012162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2422 | Open in IMG/M |
| 3300010335|Ga0134063_10208925 | Not Available | 920 | Open in IMG/M |
| 3300010361|Ga0126378_12510623 | Not Available | 589 | Open in IMG/M |
| 3300010362|Ga0126377_12538801 | Not Available | 588 | Open in IMG/M |
| 3300010376|Ga0126381_103061450 | Not Available | 663 | Open in IMG/M |
| 3300010376|Ga0126381_103286396 | Not Available | 638 | Open in IMG/M |
| 3300012189|Ga0137388_10556172 | Not Available | 1067 | Open in IMG/M |
| 3300012203|Ga0137399_10022852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4141 | Open in IMG/M |
| 3300012206|Ga0137380_10398026 | Not Available | 1223 | Open in IMG/M |
| 3300012351|Ga0137386_11229952 | Not Available | 523 | Open in IMG/M |
| 3300012359|Ga0137385_11495931 | Not Available | 539 | Open in IMG/M |
| 3300012927|Ga0137416_11642971 | Not Available | 585 | Open in IMG/M |
| 3300012948|Ga0126375_11794640 | Not Available | 535 | Open in IMG/M |
| 3300012986|Ga0164304_10950953 | Not Available | 676 | Open in IMG/M |
| 3300012988|Ga0164306_11536924 | Not Available | 572 | Open in IMG/M |
| 3300015241|Ga0137418_11305524 | Not Available | 506 | Open in IMG/M |
| 3300016294|Ga0182041_10627298 | Not Available | 947 | Open in IMG/M |
| 3300016387|Ga0182040_11798052 | Not Available | 524 | Open in IMG/M |
| 3300016422|Ga0182039_11820239 | Not Available | 558 | Open in IMG/M |
| 3300017970|Ga0187783_10958569 | Not Available | 617 | Open in IMG/M |
| 3300017995|Ga0187816_10465378 | Not Available | 567 | Open in IMG/M |
| 3300018062|Ga0187784_10517363 | Not Available | 961 | Open in IMG/M |
| 3300018064|Ga0187773_10244576 | Not Available | 977 | Open in IMG/M |
| 3300018085|Ga0187772_10757573 | Not Available | 699 | Open in IMG/M |
| 3300018085|Ga0187772_11211479 | Not Available | 556 | Open in IMG/M |
| 3300020170|Ga0179594_10187813 | Not Available | 772 | Open in IMG/M |
| 3300020199|Ga0179592_10034012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2302 | Open in IMG/M |
| 3300020583|Ga0210401_10598600 | Not Available | 964 | Open in IMG/M |
| 3300021171|Ga0210405_10241659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1429 | Open in IMG/M |
| 3300021171|Ga0210405_11246745 | Not Available | 549 | Open in IMG/M |
| 3300021178|Ga0210408_11244272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 567 | Open in IMG/M |
| 3300021372|Ga0213877_10289112 | Not Available | 553 | Open in IMG/M |
| 3300021402|Ga0210385_11059476 | Not Available | 623 | Open in IMG/M |
| 3300021432|Ga0210384_10128972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2269 | Open in IMG/M |
| 3300021478|Ga0210402_11245675 | Not Available | 671 | Open in IMG/M |
| 3300024179|Ga0247695_1044320 | Not Available | 644 | Open in IMG/M |
| 3300026312|Ga0209153_1059364 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1370 | Open in IMG/M |
| 3300026314|Ga0209268_1013383 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3211 | Open in IMG/M |
| 3300026355|Ga0257149_1059030 | Not Available | 558 | Open in IMG/M |
| 3300026514|Ga0257168_1129054 | Not Available | 563 | Open in IMG/M |
| 3300026557|Ga0179587_10062147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2178 | Open in IMG/M |
| 3300027575|Ga0209525_1165198 | Not Available | 501 | Open in IMG/M |
| 3300027616|Ga0209106_1023300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1352 | Open in IMG/M |
| 3300027645|Ga0209117_1053335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1190 | Open in IMG/M |
| 3300027869|Ga0209579_10258388 | Not Available | 936 | Open in IMG/M |
| 3300028047|Ga0209526_10895361 | Not Available | 540 | Open in IMG/M |
| 3300031231|Ga0170824_109558504 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031545|Ga0318541_10046185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2220 | Open in IMG/M |
| 3300031546|Ga0318538_10044680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2140 | Open in IMG/M |
| 3300031549|Ga0318571_10048594 | Not Available | 1256 | Open in IMG/M |
| 3300031719|Ga0306917_10706759 | Not Available | 792 | Open in IMG/M |
| 3300031720|Ga0307469_10255967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1412 | Open in IMG/M |
| 3300031747|Ga0318502_10269198 | Not Available | 997 | Open in IMG/M |
| 3300031751|Ga0318494_10296969 | Not Available | 931 | Open in IMG/M |
| 3300031764|Ga0318535_10341197 | Not Available | 670 | Open in IMG/M |
| 3300031765|Ga0318554_10245618 | Not Available | 1019 | Open in IMG/M |
| 3300031768|Ga0318509_10248726 | Not Available | 993 | Open in IMG/M |
| 3300031769|Ga0318526_10038413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1784 | Open in IMG/M |
| 3300031778|Ga0318498_10340812 | Not Available | 670 | Open in IMG/M |
| 3300031782|Ga0318552_10029378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2509 | Open in IMG/M |
| 3300031782|Ga0318552_10036499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 2280 | Open in IMG/M |
| 3300031792|Ga0318529_10038133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2027 | Open in IMG/M |
| 3300031821|Ga0318567_10258642 | Not Available | 978 | Open in IMG/M |
| 3300031831|Ga0318564_10042948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1956 | Open in IMG/M |
| 3300031845|Ga0318511_10178559 | Not Available | 938 | Open in IMG/M |
| 3300031893|Ga0318536_10068891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1737 | Open in IMG/M |
| 3300031897|Ga0318520_10552878 | Not Available | 713 | Open in IMG/M |
| 3300031912|Ga0306921_10952055 | Not Available | 971 | Open in IMG/M |
| 3300031941|Ga0310912_10825227 | Not Available | 716 | Open in IMG/M |
| 3300031941|Ga0310912_11162544 | Not Available | 588 | Open in IMG/M |
| 3300031945|Ga0310913_10424051 | Not Available | 944 | Open in IMG/M |
| 3300031946|Ga0310910_10807200 | Not Available | 739 | Open in IMG/M |
| 3300032008|Ga0318562_10113499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1545 | Open in IMG/M |
| 3300032008|Ga0318562_10829664 | Not Available | 529 | Open in IMG/M |
| 3300032041|Ga0318549_10368409 | Not Available | 647 | Open in IMG/M |
| 3300032043|Ga0318556_10004266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 5381 | Open in IMG/M |
| 3300032052|Ga0318506_10358875 | Not Available | 646 | Open in IMG/M |
| 3300032054|Ga0318570_10471284 | Not Available | 573 | Open in IMG/M |
| 3300032064|Ga0318510_10319901 | Not Available | 650 | Open in IMG/M |
| 3300032067|Ga0318524_10794719 | Not Available | 500 | Open in IMG/M |
| 3300032076|Ga0306924_10980357 | Not Available | 929 | Open in IMG/M |
| 3300032174|Ga0307470_10777448 | Not Available | 739 | Open in IMG/M |
| 3300032205|Ga0307472_100212348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1483 | Open in IMG/M |
| 3300033289|Ga0310914_11009851 | Not Available | 732 | Open in IMG/M |
| 3300033290|Ga0318519_10656195 | Not Available | 640 | Open in IMG/M |
| 3300033290|Ga0318519_10674475 | Not Available | 631 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 42.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_103224452 | 3300001593 | Forest Soil | MKRASTLTLLLLAFCGAAQAKDLIGVFEDAVHNDPVIRQADANRLAAREAR |
| Ga0066673_102223012 | 3300005175 | Soil | MNRASTLALVLLAFSGAAPAKDLVGVFEDAVHNDPVIRQADANRLAAREARPQAL |
| Ga0066388_1031385761 | 3300005332 | Tropical Forest Soil | MNRAATLALGLLALTGTAAAKDLVGVFQDAVQNDPTIKQANANRLATREA |
| Ga0008090_101025223 | 3300005363 | Tropical Rainforest Soil | MNRAATIALALLGLPLAAPAKDLIGVFEDAVHNDPVIRQADANRLAAR |
| Ga0070735_100674011 | 3300005534 | Surface Soil | MNRAAIATAGLVALLCSAVAEPKDLIGVFEDAVHNDPVIRQADANRLAAR |
| Ga0070696_1010844381 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRAATLALVLLALPLAAPAKDLIAVFEDAVHNDPVIRQADANRLAAR |
| Ga0066699_101079731 | 3300005561 | Soil | MNRASTLALVLLAFSGAAPAKDLVGVFEDAVHNDPVIRQADANR |
| Ga0066703_103777072 | 3300005568 | Soil | MKRGLTALVLLVLAGAASAKDLVGVFEDAVHNDPQIRQADANRLAAREA |
| Ga0070761_100984871 | 3300005591 | Soil | MNRAVTLALLLFAVAGSAAAKDLLGVFEDAVHSDPVIRQADANR |
| Ga0070766_105179182 | 3300005921 | Soil | MNRASTLALVLLAFSGSAPAKDLVGVFEDAVHNDPVIRQADANRLAAR |
| Ga0066696_107405012 | 3300006032 | Soil | MIRALIIAPMLLTLSGVAASKDLAGVFEDAVHNDPVIRQADANRLAAR |
| Ga0066652_1015575021 | 3300006046 | Soil | MNRASTLALVLLAFSGAAQPKDLAGVFEDAVHNDPVIRQADANRLA |
| Ga0066710_1033623822 | 3300009012 | Grasslands Soil | MKRGLAALVLLALADATSAKDLVGVFEDAVHNDPQIRQADANLLA |
| Ga0105243_103957623 | 3300009148 | Miscanthus Rhizosphere | MNRAATLTLSLLALASAAGAKDLQGVFEDALHNDP |
| Ga0105238_124894612 | 3300009551 | Corn Rhizosphere | MNRAATLTLSLLALASAAGAKDLQGVFEDALHNDPVIKQANA |
| Ga0126373_128056152 | 3300010048 | Tropical Forest Soil | MNRAATLAPFLVALPLAAPAKDLIGVFEDALHNDPVIRQADAN |
| Ga0099796_100121623 | 3300010159 | Vadose Zone Soil | MNRASTLALVLLAFSGGAPAKDLLGVFEDAVHNDPVIRQA |
| Ga0134063_102089252 | 3300010335 | Grasslands Soil | MNRASTLALVLLAFSGAAPAKDLVGVFEDAVHNDPVIRQADAN |
| Ga0126378_125106232 | 3300010361 | Tropical Forest Soil | MNRAASLALVLLALPLAAPAKDLIGVFEDAVHNDPVIRQ |
| Ga0126377_125388011 | 3300010362 | Tropical Forest Soil | MNRAATLAPFLLALPLAAPAKDLIGVFEDALHNDPVIRQADANRLAA |
| Ga0126381_1030614502 | 3300010376 | Tropical Forest Soil | MNRASTLALMLIIFAGAAQSKDLIGVFEDALHNDPVIRQADANRL |
| Ga0126381_1032863961 | 3300010376 | Tropical Forest Soil | MLVCLLGTWAGTASSKDLIGVFEDALKNDPVIRQADANRLAA |
| Ga0137388_105561722 | 3300012189 | Vadose Zone Soil | VLLAFSGAAPAKDLVGVFEDAVHNDPVIRQADANRLAAREAR |
| Ga0137399_100228521 | 3300012203 | Vadose Zone Soil | MNRASTLALVLLAFSGAAPTKDLVGVFEDAVHNDPVIRQADANRLAAREARPQ |
| Ga0137380_103980263 | 3300012206 | Vadose Zone Soil | MIRAPIIALMLLTLSGVAASKDLAGVFEDAVHNDPVIRQADANRL |
| Ga0137386_112299521 | 3300012351 | Vadose Zone Soil | MNRASTLALVLLAFSGAAPAKDLVGVFEDAVHNDPVIRQADANRL |
| Ga0137385_114959312 | 3300012359 | Vadose Zone Soil | MIRAPIIALMLLTLSGVAASKDLAGVFEDAVHNDPVI |
| Ga0137416_116429712 | 3300012927 | Vadose Zone Soil | MNRASTLALVLLAFSGAAPTKDLVGVFEDAVHNDPVIRQADAN |
| Ga0126375_117946402 | 3300012948 | Tropical Forest Soil | MNRAATLALVLLALPLAAPGKDLIGVFEDALHNDPVIRQADANRLAAR |
| Ga0164304_109509532 | 3300012986 | Soil | MNRAATLTLSLLALASAAGAKDLQGVFEDALHNDPVIKQ |
| Ga0164306_115369242 | 3300012988 | Soil | MNRAATLTLSLLALASAAGAKDLQGVFEDALHNDPVIKQA |
| Ga0137418_113055241 | 3300015241 | Vadose Zone Soil | MNRASTLALVLLTFSGAAPAKDLVGVFEDAVRNDPVIRQAD |
| Ga0182041_106272982 | 3300016294 | Soil | MNRAATLTLLLLALPLAAPAKDLIGVFEDALHNDPVIRQADANRLA |
| Ga0182040_117980521 | 3300016387 | Soil | MNRAATLALLFSALPLAAPAKDLIGVFEDALHNDPVIRQADANRLAARE |
| Ga0182039_118202392 | 3300016422 | Soil | MNRAATLAPVLLALPFAAPAKDLIGVFEDAVHNDPVIRQADDNRLA |
| Ga0187783_109585691 | 3300017970 | Tropical Peatland | MPITRVLALAVLVLGCCCAQGKDLLAVFEDAVHNDPVIRQADANRLAARES |
| Ga0187816_104653781 | 3300017995 | Freshwater Sediment | MNRVATVALALLALPLAAPAKDLIGVFEDALHNDPVIRQADANRLAAR |
| Ga0187784_105173631 | 3300018062 | Tropical Peatland | MTRAFATALLLLVFAGAAQPKDLIGVFEDAVHNDPVILQADANRLAARE |
| Ga0187773_102445762 | 3300018064 | Tropical Peatland | MKRAAPFACLLLGFAATAQPKDLIGVFEDALHNDPVIRQA |
| Ga0187772_107575731 | 3300018085 | Tropical Peatland | MKRVAAVMLALLPLSGGAQGKDLIGVFQDALQNDPVIRQADANR |
| Ga0187772_112114792 | 3300018085 | Tropical Peatland | MKRAATLACLLAGFAGSAQPKDLVGVFEDALKNDPVIRQADANRLAARE |
| Ga0179594_101878131 | 3300020170 | Vadose Zone Soil | MNRASTLALVLLAFSGGAPAKDLLGVFEDAVHNDPVIRQADANRL |
| Ga0179592_100340121 | 3300020199 | Vadose Zone Soil | MNRAPTLALVLLAFSGTAPAKDLVGVFEDAVHNDP |
| Ga0210401_105986001 | 3300020583 | Soil | MTRAITLTACLLACAGLANAKDLTGVFEDAVKNDPVIRQADANRMA |
| Ga0210405_102416591 | 3300021171 | Soil | MRAITLACLLAGFASTAQPNDLVGVFEDALKSDPVIRQADANR |
| Ga0210405_112467451 | 3300021171 | Soil | MNRAATLLLGLLFYCAAAQPKDLVGVFEDALHNDPVIRQADANRLA |
| Ga0210408_112442722 | 3300021178 | Soil | MNRAATLALVLLVSTGAAGAKDLVGVFEDAVNNDPVIRQADANRLAAREARPQALAAV |
| Ga0213877_102891121 | 3300021372 | Bulk Soil | MSRASRLALVLLSFAGAAQARDLVGVFEDALRSDPVIRQAEANRMAS |
| Ga0210385_110594762 | 3300021402 | Soil | MTRACTLALLLLAISGAAHSKDLIGVFEDAVHNDPVIRQADANR |
| Ga0210384_101289721 | 3300021432 | Soil | MNRASTLALVLLGFSGSAPAKDLVGVFEDAVHNDPVIRQADANRLAAREARPQA |
| Ga0210402_112456752 | 3300021478 | Soil | MNRAPTLALVLLAFSGAAGAKDLVGVFEDAVHNDPVIRQADANRLAARE |
| Ga0247695_10443202 | 3300024179 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDAVHNDPVIR |
| Ga0209153_10593643 | 3300026312 | Soil | MIRAPIIALTLLTLSGVAASKDLAGVFEDAVHNDPVIRQADANRL |
| Ga0209268_10133834 | 3300026314 | Soil | MNRASTLALVLLAFSGAAPAKDLVGVFEDAVHNDPVI |
| Ga0257149_10590302 | 3300026355 | Soil | MNRAPTLALVLLAFSGTAPAKDLVGVFEDAVHNDPVIRQADANRLAAREA |
| Ga0257168_11290541 | 3300026514 | Soil | MNMSRALGLALALLAATAAAPAKDLIGVFEDALMNDP |
| Ga0179587_100621471 | 3300026557 | Vadose Zone Soil | MNRAPTLALVLLAFSGTAPAKDLVGVFEDAVHNDPVIRQADA |
| Ga0209525_11651981 | 3300027575 | Forest Soil | MNRASTLALVLLAFSGTAPAKDLVGVFEDAVHNDPVIRQADAIGGIHGIG |
| Ga0209106_10233003 | 3300027616 | Forest Soil | MNRAPTLALVILAFSGTAPAKDLVGVFEDAVHNDPVIRQADA |
| Ga0209117_10533351 | 3300027645 | Forest Soil | MNRASTLALVLLAFSGAAPAMDLVGVFEDAVHNDPVIRQADA |
| Ga0209579_102583881 | 3300027869 | Surface Soil | MKRAAVLALAALAVTGAAQGKDLIGVFEDAVHNDPVIRQADANRL |
| Ga0209526_108953612 | 3300028047 | Forest Soil | MNRASTLALVLLAFSGTAPAKDLVGVFEDAVHNDPVIRQADAN |
| Ga0170824_1095585042 | 3300031231 | Forest Soil | MNRAATLLLVLLVTAAPAQPKDLVGVFEDALRNDPVIRQADANRLAAREARPQ |
| Ga0318541_100461853 | 3300031545 | Soil | MNRAATVALALLALPLAAPAKDLIGVFEDALHNDPVIRQADDRVIVE |
| Ga0318538_100446801 | 3300031546 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDALHNDPVIRQAD |
| Ga0318571_100485941 | 3300031549 | Soil | MNRAATIALALLALPLAAPAKDLIGVFEDALQNDPVIRQADANRL |
| Ga0306917_107067592 | 3300031719 | Soil | MNRAATLALLLLAFSATAPANDLIGVFEDALHNDPVIRQAD |
| Ga0307469_102559673 | 3300031720 | Hardwood Forest Soil | MNRASTFALVLLAFSGTAPAKDLVGVFEDAVHNDPVIRQ |
| Ga0318502_102691981 | 3300031747 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDALHNDPVIRQADANR |
| Ga0318494_102969691 | 3300031751 | Soil | MNRAATLAPVLLALPLAAPAKDLIGVFEDAVHNDPVIR |
| Ga0318535_103411972 | 3300031764 | Soil | MNRAATLAPVLLALPLAAPAKDLIGVFEDAVHNDP |
| Ga0318554_102456182 | 3300031765 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDALHNDPVIRQADA |
| Ga0318509_102487262 | 3300031768 | Soil | MNRAATLAPVLLALPLAAPAKDLIGVFEDAVHNDPVIRQADANRLA |
| Ga0318526_100384131 | 3300031769 | Soil | MNRAATLAPVLLALPLAAPAKDLIGVFEDAVHNDPV |
| Ga0318498_103408122 | 3300031778 | Soil | MNRAATLALYLFALPLAAPAKDLTGVFEDALQNDPVIR |
| Ga0318552_100293783 | 3300031782 | Soil | MNRAATLTLLLLALPLAAPAKDLIGVFEDALHNDP |
| Ga0318552_100364991 | 3300031782 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDALHNDPVIR |
| Ga0318529_100381331 | 3300031792 | Soil | MNRAATIALALLALPLAAPAKDLIGVFEDALQNDPV |
| Ga0318567_102586422 | 3300031821 | Soil | MNRAATLTLLLLALPLAAPAKDLIGVFEDALHNDPVIRQADANRLAARE |
| Ga0318564_100429483 | 3300031831 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDAVHNDPV |
| Ga0318511_101785591 | 3300031845 | Soil | MNRAATLTLLLLALPLAAPAKDLIGVFEDALHNDPVIRQADANRLAAR |
| Ga0318536_100688913 | 3300031893 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDAVHNDPVIRQADANRLAARESK |
| Ga0318520_105528781 | 3300031897 | Soil | MNRASKLALLLLVAGAAEAKDLVGVYDDALHNDPVIRQADANRLAARESR |
| Ga0306921_109520552 | 3300031912 | Soil | MNRAATLALLFSALPLAAPAKDLIGVFEDALHNDPVIRQ |
| Ga0310912_108252271 | 3300031941 | Soil | MNRAATLALLFSALPLAAPAKDLIGVFEDALHNDPVIRQADANRLAARESK |
| Ga0310912_111625442 | 3300031941 | Soil | MNRAATLALFLFALPLAAPAKDLIGVFEDALHNDPVIRQ |
| Ga0310913_104240512 | 3300031945 | Soil | MNRAATLALLFSALPLAAPAKDLIGVFEDALHNDPVIRQADANRL |
| Ga0310910_108072002 | 3300031946 | Soil | MNRAATLTLLLLALPLAAPAKDLIGVFEDALHNDPVI |
| Ga0318562_101134993 | 3300032008 | Soil | MNRAATLALYLFALPLAAPAKDLIGVFEDALHNDPVIR |
| Ga0318562_108296642 | 3300032008 | Soil | MNRAATLTLLLLALPLAAPAKDLIGVFEDALHNDPVIRQA |
| Ga0318549_103684091 | 3300032041 | Soil | MNRAATLALYLFALPLAAPAKDLIGVFEDALHNDPVIRQAD |
| Ga0318556_100042664 | 3300032043 | Soil | MNRAATLALLFSALPLAAPAKDLIGVFEDALHNDPV |
| Ga0318506_103588751 | 3300032052 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDAVHNDPVIRQADAN |
| Ga0318570_104712841 | 3300032054 | Soil | MNRAATLALYLFALPLAAPAKDLTGVFEDALQNDPVIRQADANRLA |
| Ga0318510_103199012 | 3300032064 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDAVHNDPVIRQADANR |
| Ga0318524_107947191 | 3300032067 | Soil | MNRAATLALVLLALPLAAPAKDLIGVFEDALHNDPVIRQADAN |
| Ga0306924_109803572 | 3300032076 | Soil | MNRAATLALYLFALPLAAPAKDLIGVFEDALHNDPVI |
| Ga0307470_107774482 | 3300032174 | Hardwood Forest Soil | MNRASTLALVLLAFSGTAPAKDLVGVFEDAVHNDPVIRQA |
| Ga0307472_1002123483 | 3300032205 | Hardwood Forest Soil | MTRAITLTVCLLSCAGLADAKDLRGVFEDAVKNDPVIRQAEANRMAA |
| Ga0310914_110098512 | 3300033289 | Soil | MNRAATLTLLLLALPLAAPAKDLIGVFEDALHNDPVIRQ |
| Ga0318519_106561952 | 3300033290 | Soil | MNRAATIALALLALPLAAPAKDLIGVFEDALQNDPVIR |
| Ga0318519_106744752 | 3300033290 | Soil | MNRAATLAPVLLALPLAAPAKDLIGVFEDAVHNDPVIRQADDR |
| ⦗Top⦘ |