| Basic Information | |
|---|---|
| Family ID | F102003 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSEAVEQLKRKVASLKRESEELRRYKRDIDWLKTLQKKLVRDGFD |
| Number of Associated Samples | 28 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 43.14 % |
| % of genes near scaffold ends (potentially truncated) | 14.71 % |
| % of genes from short scaffolds (< 2000 bps) | 63.73 % |
| Associated GOLD sequencing projects | 26 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (63.725 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (46.078 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.980 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (55.882 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.79% β-sheet: 0.00% Coil/Unstructured: 45.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 5.94 |
| PF01850 | PIN | 4.95 |
| PF05096 | Glu_cyclase_2 | 4.95 |
| PF00246 | Peptidase_M14 | 4.95 |
| PF13367 | PrsW-protease | 4.95 |
| PF14417 | MEDS | 3.96 |
| PF00903 | Glyoxalase | 2.97 |
| PF02142 | MGS | 2.97 |
| PF13240 | zinc_ribbon_2 | 1.98 |
| PF13419 | HAD_2 | 1.98 |
| PF04014 | MazE_antitoxin | 1.98 |
| PF00881 | Nitroreductase | 1.98 |
| PF04951 | Peptidase_M55 | 1.98 |
| PF04307 | YdjM | 1.98 |
| PF05922 | Inhibitor_I9 | 0.99 |
| PF01935 | DUF87 | 0.99 |
| PF13669 | Glyoxalase_4 | 0.99 |
| PF07555 | NAGidase | 0.99 |
| PF02915 | Rubrerythrin | 0.99 |
| PF02784 | Orn_Arg_deC_N | 0.99 |
| PF00005 | ABC_tran | 0.99 |
| PF01909 | NTP_transf_2 | 0.99 |
| PF10988 | DUF2807 | 0.99 |
| PF05168 | HEPN | 0.99 |
| PF00011 | HSP20 | 0.99 |
| PF13186 | SPASM | 0.99 |
| PF02709 | Glyco_transf_7C | 0.99 |
| PF00583 | Acetyltransf_1 | 0.99 |
| PF01877 | RNA_binding | 0.99 |
| PF00162 | PGK | 0.99 |
| PF05016 | ParE_toxin | 0.99 |
| PF04471 | Mrr_cat | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 4.95 |
| COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 1.98 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.99 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.99 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.99 |
| COG1404 | Serine protease, subtilisin family | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.99 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.61 % |
| Unclassified | root | N/A | 30.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001854|JGI24422J19971_10001186 | All Organisms → cellular organisms → Archaea | 15718 | Open in IMG/M |
| 3300010324|Ga0129297_10195914 | All Organisms → cellular organisms → Archaea → TACK group | 929 | Open in IMG/M |
| 3300010324|Ga0129297_10379448 | Not Available | 631 | Open in IMG/M |
| 3300010328|Ga0129298_10177985 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → unclassified Thermoprotei → Thermoprotei archaeon | 997 | Open in IMG/M |
| 3300010328|Ga0129298_10430359 | Not Available | 604 | Open in IMG/M |
| 3300012931|Ga0153915_10012426 | All Organisms → cellular organisms → Archaea | 8186 | Open in IMG/M |
| 3300012931|Ga0153915_10039508 | All Organisms → cellular organisms → Archaea | 4788 | Open in IMG/M |
| 3300012931|Ga0153915_10168049 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300012931|Ga0153915_10318444 | All Organisms → cellular organisms → Archaea | 1741 | Open in IMG/M |
| 3300012931|Ga0153915_10409938 | All Organisms → cellular organisms → Archaea | 1535 | Open in IMG/M |
| 3300012931|Ga0153915_10548860 | All Organisms → cellular organisms → Archaea | 1325 | Open in IMG/M |
| 3300012931|Ga0153915_10889048 | Not Available | 1035 | Open in IMG/M |
| 3300012931|Ga0153915_11178377 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 895 | Open in IMG/M |
| 3300012931|Ga0153915_11196103 | All Organisms → cellular organisms → Archaea | 888 | Open in IMG/M |
| 3300012931|Ga0153915_12128140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 657 | Open in IMG/M |
| 3300012931|Ga0153915_13116276 | Not Available | 539 | Open in IMG/M |
| 3300012964|Ga0153916_10046098 | All Organisms → cellular organisms → Archaea → TACK group | 3903 | Open in IMG/M |
| 3300012964|Ga0153916_10047379 | All Organisms → cellular organisms → Archaea | 3856 | Open in IMG/M |
| 3300012964|Ga0153916_10071409 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3199 | Open in IMG/M |
| 3300012964|Ga0153916_10467252 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300012964|Ga0153916_10477946 | Not Available | 1314 | Open in IMG/M |
| 3300012964|Ga0153916_10884327 | Not Available | 974 | Open in IMG/M |
| 3300012964|Ga0153916_10904347 | All Organisms → cellular organisms → Archaea → TACK group | 963 | Open in IMG/M |
| 3300012964|Ga0153916_11474806 | All Organisms → cellular organisms → Archaea | 756 | Open in IMG/M |
| 3300012964|Ga0153916_11576173 | Not Available | 731 | Open in IMG/M |
| 3300012964|Ga0153916_11732431 | Not Available | 698 | Open in IMG/M |
| 3300012964|Ga0153916_11914487 | Not Available | 664 | Open in IMG/M |
| 3300012964|Ga0153916_11919904 | All Organisms → cellular organisms → Archaea → TACK group | 663 | Open in IMG/M |
| 3300012964|Ga0153916_12483302 | Not Available | 584 | Open in IMG/M |
| 3300012964|Ga0153916_12562976 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 574 | Open in IMG/M |
| 3300012964|Ga0153916_12680999 | Not Available | 562 | Open in IMG/M |
| 3300018064|Ga0187773_10942079 | Not Available | 561 | Open in IMG/M |
| 3300022208|Ga0224495_10009016 | All Organisms → cellular organisms → Archaea | 5364 | Open in IMG/M |
| 3300022208|Ga0224495_10068398 | Not Available | 1585 | Open in IMG/M |
| 3300022208|Ga0224495_10123640 | Not Available | 1119 | Open in IMG/M |
| 3300022208|Ga0224495_10134139 | Not Available | 1065 | Open in IMG/M |
| 3300022208|Ga0224495_10176974 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 900 | Open in IMG/M |
| 3300022208|Ga0224495_10218427 | Not Available | 790 | Open in IMG/M |
| 3300022221|Ga0224506_10053124 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2027 | Open in IMG/M |
| 3300022221|Ga0224506_10109789 | All Organisms → cellular organisms → Archaea → TACK group | 1323 | Open in IMG/M |
| 3300022551|Ga0212089_10126955 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → unclassified Thermoprotei → Thermoprotei archaeon | 1329 | Open in IMG/M |
| 3300025143|Ga0209314_10293117 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → unclassified Thermoprotei → Thermoprotei archaeon | 512 | Open in IMG/M |
| 3300027888|Ga0209635_10640433 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 787 | Open in IMG/M |
| 3300027893|Ga0209636_10028008 | All Organisms → cellular organisms → Archaea | 5683 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10218475 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1000039 | All Organisms → cellular organisms → Archaea | 61952 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1000039 | All Organisms → cellular organisms → Archaea | 61952 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1000586 | All Organisms → cellular organisms → Archaea | 20552 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1001315 | All Organisms → cellular organisms → Archaea | 14280 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1004493 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 7764 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1006780 | All Organisms → cellular organisms → Archaea | 6201 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1017751 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3565 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1018775 | All Organisms → cellular organisms → Bacteria | 3448 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1044097 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota | 2037 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1065836 | Not Available | 1571 | Open in IMG/M |
| (restricted) 3300031587|Ga0315308_1168249 | Not Available | 837 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1007538 | All Organisms → cellular organisms → Archaea | 4721 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1020321 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2722 | Open in IMG/M |
| (restricted) 3300031593|Ga0315307_1049079 | Not Available | 1621 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1009975 | All Organisms → cellular organisms → Archaea | 5112 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1020429 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 3368 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1048113 | All Organisms → cellular organisms → Archaea → TACK group | 1991 | Open in IMG/M |
| (restricted) 3300031604|Ga0315309_1125185 | Not Available | 1067 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10015198 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 3146 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10047401 | All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota | 1685 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10075584 | Not Available | 1301 | Open in IMG/M |
| (restricted) 3300031806|Ga0315306_10115699 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1023 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10002432 | All Organisms → cellular organisms → Archaea | 11620 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10018360 | All Organisms → cellular organisms → Archaea | 4104 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10064545 | All Organisms → cellular organisms → Archaea → TACK group | 1903 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10224884 | All Organisms → cellular organisms → Archaea | 828 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10228504 | Not Available | 819 | Open in IMG/M |
| (restricted) 3300031876|Ga0315310_10453386 | Not Available | 509 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1000279 | All Organisms → cellular organisms → Archaea | 65001 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1002331 | All Organisms → cellular organisms → Archaea | 15793 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1005974 | Not Available | 8671 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1011999 | All Organisms → cellular organisms → Archaea | 5515 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1012078 | All Organisms → cellular organisms → Archaea → TACK group | 5489 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1058847 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1807 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1092663 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1108493 | Not Available | 1145 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1109157 | Not Available | 1140 | Open in IMG/M |
| (restricted) 3300031877|Ga0315314_1122506 | All Organisms → cellular organisms → Archaea → TACK group | 1045 | Open in IMG/M |
| 3300032020|Ga0315296_10001735 | All Organisms → cellular organisms → Archaea | 18954 | Open in IMG/M |
| 3300032020|Ga0315296_10003201 | All Organisms → cellular organisms → Archaea | 13761 | Open in IMG/M |
| 3300032020|Ga0315296_10060608 | All Organisms → cellular organisms → Archaea | 2521 | Open in IMG/M |
| 3300032020|Ga0315296_10266687 | All Organisms → cellular organisms → Archaea → TACK group | 987 | Open in IMG/M |
| 3300032020|Ga0315296_10276591 | Not Available | 963 | Open in IMG/M |
| 3300032118|Ga0315277_10139578 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2697 | Open in IMG/M |
| 3300032173|Ga0315268_10017687 | All Organisms → cellular organisms → Archaea | 7132 | Open in IMG/M |
| 3300032173|Ga0315268_10809375 | All Organisms → cellular organisms → Archaea | 938 | Open in IMG/M |
| 3300033486|Ga0316624_12178789 | All Organisms → cellular organisms → Archaea → TACK group | 516 | Open in IMG/M |
| 3300033513|Ga0316628_100662829 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1366 | Open in IMG/M |
| 3300033513|Ga0316628_101084625 | All Organisms → cellular organisms → Archaea | 1064 | Open in IMG/M |
| 3300034078|Ga0373900_000921 | All Organisms → cellular organisms → Archaea | 3436 | Open in IMG/M |
| 3300034078|Ga0373900_049539 | Not Available | 758 | Open in IMG/M |
| 3300034078|Ga0373900_058745 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 705 | Open in IMG/M |
| 3300034083|Ga0373901_097079 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota | 615 | Open in IMG/M |
| 3300034099|Ga0373902_088531 | Not Available | 691 | Open in IMG/M |
| 3300034099|Ga0373902_117650 | Not Available | 614 | Open in IMG/M |
| 3300034099|Ga0373902_175535 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 519 | Open in IMG/M |
| 3300034191|Ga0373909_0144715 | Not Available | 734 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 46.08% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 25.49% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 7.84% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 7.84% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 5.88% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001854 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 | Environmental | Open in IMG/M |
| 3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
| 3300010328 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022551 | Boni_combined assembly | Environmental | Open in IMG/M |
| 3300025143 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
| 3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300031587 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 | Environmental | Open in IMG/M |
| 3300031593 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP2 | Environmental | Open in IMG/M |
| 3300031604 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4 | Environmental | Open in IMG/M |
| 3300031806 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP1 | Environmental | Open in IMG/M |
| 3300031876 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5 | Environmental | Open in IMG/M |
| 3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034078 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.1 | Engineered | Open in IMG/M |
| 3300034083 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.2 | Engineered | Open in IMG/M |
| 3300034099 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3 | Engineered | Open in IMG/M |
| 3300034191 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24422J19971_1000118614 | 3300001854 | Marine Sediment | MSEAVEHLKRKVASLKRESEELQRYERDIDWIKTLKKKLVRNGFD* |
| Ga0129297_101959141 | 3300010324 | Lake Sediment | MSESVEQVKRKVASLKRESEELQRYKRDIDWLKTLQKKLVRDGFD* |
| Ga0129297_103794481 | 3300010324 | Lake Sediment | MNEAVEQLKRRVASLVREYEELQRYKRDIDWLKTLQQKLVKDRYD* |
| Ga0129298_101779853 | 3300010328 | Lake Sediment | LVGGLFFVFVERIMSEAVEQLRRKVASLAREWEELQRYKRDLDWLKKLQQRIVKDIFD* |
| Ga0129298_104303592 | 3300010328 | Lake Sediment | MSGAVDQLRRRVASLTREAEELQRYKRDIDWLKTLQKKLVRHGFD* |
| Ga0153915_100124266 | 3300012931 | Freshwater Wetlands | MDDVEHIRRKVASLMKESEELQRYKKDLDWLRTLQKKLVRERLD* |
| Ga0153915_100395085 | 3300012931 | Freshwater Wetlands | MTESVEQLKRKVAGLMKESEELRRFRKDIDWLKTLQKKVVKDKFD* |
| Ga0153915_101680492 | 3300012931 | Freshwater Wetlands | MTEALEQLKRKVANLKKESEELQRYKKEIDWLKTLQKKLVKDDFD* |
| Ga0153915_103184442 | 3300012931 | Freshwater Wetlands | MRFLWVEMSEAIDQLRRRVAGLTKEFKELQSYKKDIEWLKTLEKKLVKEGFD* |
| Ga0153915_104099383 | 3300012931 | Freshwater Wetlands | MVVVFFVVDMDESVEQIKRKVAGLMKDSEDLNRFRKDIDWLKTIQKKVVKAKFD* |
| Ga0153915_105488602 | 3300012931 | Freshwater Wetlands | MRVSFVVAMSESVEQLKRRVASLMKESEELKRFRKDIDWLKTLQKKVVKDRFD* |
| Ga0153915_108890482 | 3300012931 | Freshwater Wetlands | MGEAVEQLKRKVASLMKESEELQRYGKDIEWLKTLRKKLAKNGFD* |
| Ga0153915_111783772 | 3300012931 | Freshwater Wetlands | VADMSESVEQLKRKVAGLMKESEELRRFRRDIDWLKTLQKKVVKDKFD* |
| Ga0153915_111961032 | 3300012931 | Freshwater Wetlands | MVSRVVVVDMDESVEKLKRKVAGLMKDSEDLNRFRKDIDWLKTIQKKVVKDKFD* |
| Ga0153915_121281402 | 3300012931 | Freshwater Wetlands | SDLVDEMTDALEQLKRKVANLKQESEELQRYKKDIDWLKTLQKKLVKDGFD* |
| Ga0153915_131162761 | 3300012931 | Freshwater Wetlands | MDESVEQLKRKVAGLMKDSDDLNRFRKDIDWLKTLQKKVVKAKFD* |
| Ga0153916_100460984 | 3300012964 | Freshwater Wetlands | MTESVEQLKRKVAGLMKESEELHRFRRDIDWLKTLQKKVVKDKFD* |
| Ga0153916_100473791 | 3300012964 | Freshwater Wetlands | MDDVEHIRRKVASLMKESEELQRYKKDLDWLRTLQKKLV |
| Ga0153916_100714092 | 3300012964 | Freshwater Wetlands | MSESVEQLKRKVAGLMKESEELRRFRRDIDWLKTLQKKVVKDKFD* |
| Ga0153916_104672522 | 3300012964 | Freshwater Wetlands | MTEALEQLKRKVANLKQESEELQRYKKDIDWLKTLQKKLVKDSFD* |
| Ga0153916_104779463 | 3300012964 | Freshwater Wetlands | MSEAVEQLKRKVASLMKESEELQRYGKDIEWLKTLRKKLAKNGFD* |
| Ga0153916_108843272 | 3300012964 | Freshwater Wetlands | MDDVEHIRRKVASLMKESEELQRYKKDLDWLRTLQKKLVKERLD* |
| Ga0153916_109043473 | 3300012964 | Freshwater Wetlands | MPLSFVVDMSESVEQLKRKVAGLMKDSEELRRFRRDIDWLKTLQKKVVKDKFD* |
| Ga0153916_114748062 | 3300012964 | Freshwater Wetlands | MRVSFVVAMSESVEQLKRRVASLMKESEEIKRFRKDIDWLKTLQKKVVKDRFD* |
| Ga0153916_115761731 | 3300012964 | Freshwater Wetlands | MSESVEQLKRKVAGLMKESEELHRFRRDIDWLKTLQKKVVKDKFD* |
| Ga0153916_117324312 | 3300012964 | Freshwater Wetlands | MRVSFVVVMSEGVELLKRKVAGLMRESEELKRFRKDIDWLKSLQKKVVKDRFD* |
| Ga0153916_119144872 | 3300012964 | Freshwater Wetlands | MDESVEQLKRKVAGLMKDSEDLNRFRKDIDWLKTLQKKVVKAKFD* |
| Ga0153916_119199042 | 3300012964 | Freshwater Wetlands | VGFFVFVVVMSEAVEQLKRKVASLTKESEELQRYKRDIDWLKTLQKKLVRDGFD* |
| Ga0153916_124833021 | 3300012964 | Freshwater Wetlands | MRVFFVVAMSESIEQLKRKVASLMKESEELKRFRKDIDWLKTLQKKVVKDRFD* |
| Ga0153916_125629762 | 3300012964 | Freshwater Wetlands | MVVVFFVVDMGESVEQLKRKVAGLMKDSEDLNRFRKDIDWLKTIQK |
| Ga0153916_126809991 | 3300012964 | Freshwater Wetlands | VADMSESVEQLKRKVAGLMKESEELRRFRRDIDWLKTLQKKVVKGKFD* |
| Ga0187773_109420792 | 3300018064 | Tropical Peatland | VRVRGIWMGEAVEQLKRRVASLTKESEELQRFKKDIDWLKILQKKFVKEGFD |
| Ga0224495_100090167 | 3300022208 | Sediment | MRVSFVVVMSEGVEQLKRKVASLMKESEELNRFRRDIDWLKTLQKKVVKDRFD |
| Ga0224495_100683981 | 3300022208 | Sediment | LKRKVGSLKRESEELQRYKKDIDWIKTLKKKLVRNGFD |
| Ga0224495_101236402 | 3300022208 | Sediment | VSFVVVMSEGVEQLKRKVASLMKESEELNRFRRDIDWLKTLQKKVVKDRFD |
| Ga0224495_101341392 | 3300022208 | Sediment | VFFVVVMSEGVEQLKRKVASLMKESEELKRFRKDIDWLKTLQKKVVKDRFD |
| Ga0224495_101769742 | 3300022208 | Sediment | MPLSFVVNMDESVEQLKRKVANLMKDSEELTRFRKDIDWLKTIQKRVVKDKFD |
| Ga0224495_102184272 | 3300022208 | Sediment | MPLSFVVNMDESVEQLKRKVANLMKDSEELTRFRKDIDWLKTLQKRVVKAKFD |
| Ga0224506_100531242 | 3300022221 | Sediment | MSETIERFRSKVASLKKEAEELQRYKLDIDWLKKLQKKLLTDGFD |
| Ga0224506_101097894 | 3300022221 | Sediment | MRLFLVVVMSEGVEQLKRKVAGLMKESEELKRFRKDIDWLKSLQKKVVKDRFD |
| Ga0212089_101269553 | 3300022551 | Lake Sediment | MSEAVEQLRRKVASLAREWEELQRYKRDLDWLKKLQQRIVKDIFD |
| Ga0209314_102931172 | 3300025143 | Lake Sediment | VEQLRRKVASLAREWEELQRYKRDLDWLKKLQQRIVKDIFD |
| Ga0209635_106404332 | 3300027888 | Marine Sediment | VDKMSEAVEHLKRKVASLKRESEELQRYERDIDWIKTLKKKLVRNGFD |
| Ga0209636_100280082 | 3300027893 | Marine Sediment | MSEAVEHLKRKVASLKRESEELQRYERDIDWIKTLKKKLVRNGFD |
| (restricted) Ga0233417_102184751 | 3300028043 | Sediment | PVASDLVDKLTEALEQLKRKVANLKEESEELQRYKKDIDWLKTLQKKLVRDGFD |
| (restricted) Ga0315308_100003918 | 3300031587 | Sediment | MSGVVEQLRRRVASLKRESKELQCYKRDIDWLKILQKKLVRNGFD |
| (restricted) Ga0315308_100003928 | 3300031587 | Sediment | MSGAVEQLKRKVASLTKESEELERYRRDIDWLKTLHEKLVKDRFD |
| (restricted) Ga0315308_10005868 | 3300031587 | Sediment | VEKLSEAIERLKRKVARLREESEELESFRRDIDWLKTLRKKRVRSGFD |
| (restricted) Ga0315308_10013154 | 3300031587 | Sediment | LVGGLFFVFVERIMSEAVEQLRRKVASLAREWEELQRYKRDLDWLKKLQQRIVKDIFD |
| (restricted) Ga0315308_10044933 | 3300031587 | Sediment | MSEAVEHFKRKVARLKRESEELQRYKRDIDWLKTLQKKLVREGFD |
| (restricted) Ga0315308_10067809 | 3300031587 | Sediment | MSEAVEHLRRKVEGLKRESEELQRYKRDIDWLKTLQKKLVREGFD |
| (restricted) Ga0315308_10177513 | 3300031587 | Sediment | LSQGKSTAVPVARMSEAVEHFKRKVASLKKESEELQRYKRDIDWLKTLQKKLVREGFD |
| (restricted) Ga0315308_10187757 | 3300031587 | Sediment | MSEAVEQLKRKVASLKRESEELRRYKRDIDWLKTLQKKLVRDGFD |
| (restricted) Ga0315308_10440973 | 3300031587 | Sediment | MSEAVEQFKRKVASLKKEAEELQRYRRDIDWLKTLQKKLVREGFD |
| (restricted) Ga0315308_10658362 | 3300031587 | Sediment | LRVSEAVEQLKRKVASLMEESEELKRYKRDIDWLKTLQKRLVRDGFD |
| (restricted) Ga0315308_11682492 | 3300031587 | Sediment | MSESIEQFKLKLASLKKDSEDLQRYKKDIDWLKTLRKELVRNGFD |
| (restricted) Ga0315307_10075388 | 3300031593 | Sediment | VKAVSAFCGLRVSEAVEQLKRKVASLMEESEELKRYKRDIDWLKTLQKRLVRDGFD |
| (restricted) Ga0315307_10203214 | 3300031593 | Sediment | GKSTAVLVAKMSEAVEHFRRKVASLKRESEELQRYKRDMDWLKTLQKKLVREGFD |
| (restricted) Ga0315307_10490793 | 3300031593 | Sediment | MSEAVENFKRKVARLKRESEELQRYKRDIDWLKTLQKKLVREGFD |
| (restricted) Ga0315309_10099751 | 3300031604 | Sediment | VEKLSEAIERLKRKVARLREESEELESFRRDIDWLKTLRKK |
| (restricted) Ga0315309_10204293 | 3300031604 | Sediment | MSEPVEHFRRKVASLKRESEELQRYKRDIDWLKTLQKKLVREGFD |
| (restricted) Ga0315309_10481133 | 3300031604 | Sediment | MTEAMEQLRRKVASLMKEGEELQRHKRDIDWLKALQKKLVREGFD |
| (restricted) Ga0315309_11251852 | 3300031604 | Sediment | MSEAVEHFKRKVASLKRESEELQRYKRDIDWLKALQKKLVREGFD |
| (restricted) Ga0315306_100151983 | 3300031806 | Sediment | MSEAVEHLKRKVEGLKRESEELQRYKRDIDWLKTLQKKLVREGFD |
| (restricted) Ga0315306_100474012 | 3300031806 | Sediment | VVSWMGMSEAVEQFKRKVASLKKEAEELQRYRRDIDWLKTLQKKLVREGFD |
| (restricted) Ga0315306_100755841 | 3300031806 | Sediment | ARMSEAVEHFKRKVASLKKESEELQRYKRDIDWLKMLQKKLVREGFD |
| (restricted) Ga0315306_101156992 | 3300031806 | Sediment | VRFCGWLRLSEAVEQLRRRVASLARESEELQRYKRDIDWLKTLQKKLVRHGFD |
| (restricted) Ga0315310_100024329 | 3300031876 | Sediment | VEKLSEAIEQLKRKVASLREESEELESFRRDIDWLKTLRKKRVRNGFD |
| (restricted) Ga0315310_1001836010 | 3300031876 | Sediment | MSEAVEHLKRKVASLKRESEELRRYKRDIDWLKTLQKKLVRDGFD |
| (restricted) Ga0315310_100645455 | 3300031876 | Sediment | MSEAVEQLKRRVASLVREGEELQRYRRDIDWLKTMQQKLVKDRYD |
| (restricted) Ga0315310_102248842 | 3300031876 | Sediment | VDKLSEAIEQLKRKVARLREESEELESFRRDIDWLKTLRKKRVRNGFD |
| (restricted) Ga0315310_102285041 | 3300031876 | Sediment | MGMSEAVEQFKRKVASLKKEAEELQRYRRDIDWLKTLQKKLVREGFD |
| (restricted) Ga0315310_104533861 | 3300031876 | Sediment | VCLLIEMGEAVEQLKRRVAGLVRESEELQRYRRDIDWLKTLQKKVVRDGLD |
| (restricted) Ga0315314_100027910 | 3300031877 | Sediment | MSEAVEQLRCKVASLSRESEELQRYKRDIDWLKTLQKKLVRDGFD |
| (restricted) Ga0315314_10023316 | 3300031877 | Sediment | LWVLRMSEAVERLKRKVAGLVRESEELQRYKRDIDWLRALRVKLVRDGFD |
| (restricted) Ga0315314_10059748 | 3300031877 | Sediment | MSGAVEQLRRKVASLSREAEELQRYKRDIDWLKTLQRKVVRDGFD |
| (restricted) Ga0315314_10119999 | 3300031877 | Sediment | MSGVVEQLKRKVASLTRESEELQRYKRDIDWLKTLQKKLVTNDFD |
| (restricted) Ga0315314_10120786 | 3300031877 | Sediment | MGEAVEHFKRKVASLKRESEELQRYKRDIDWLKTLQKKLVRDGFD |
| (restricted) Ga0315314_10588472 | 3300031877 | Sediment | MVAMSEAVEQLKRKVASVVRESEELQRYRRDIDWLKTLQKRVVKDGFD |
| (restricted) Ga0315314_10926632 | 3300031877 | Sediment | VCLLIEMSEAVEQLKRRVAGLVRESEELQRYRRDIDWLKTLQKKLVRDGLD |
| (restricted) Ga0315314_11084931 | 3300031877 | Sediment | VSEAVERLKRKVASLVREGEELQRYRRDIDWLKTLHEKLVKDRYD |
| (restricted) Ga0315314_11091573 | 3300031877 | Sediment | SRKVGCAFFVEKIMSGAVEQLKRKVASLVRESEELQRYKRDIDWLKTLQRKVVKDRYD |
| (restricted) Ga0315314_11225062 | 3300031877 | Sediment | MSGAVEQLKRRVASLVREAEELQRYKRDIDWLKTLQKKLVKDGFD |
| Ga0315296_1000173519 | 3300032020 | Sediment | VSFVVVMSEGVELLERKVAGLMRESEELKRFRKDIDWLKSLQKKVVKDRFD |
| Ga0315296_1000320118 | 3300032020 | Sediment | LFSWANMSESVEQLKRKVAGLMKESEELHRYRRDIDWLKTLQKKVVKDRFD |
| Ga0315296_100606084 | 3300032020 | Sediment | MSEAIEQLKRKVVSLTKESEELQRYKRDVDWLKTLQKKIVREGFD |
| Ga0315296_102666872 | 3300032020 | Sediment | VLAVVFVAEMSESVEQLKRKVAGLMKESEELHRYRRDIDWLKTLQKKVVKDRFD |
| Ga0315296_102765911 | 3300032020 | Sediment | MSESVEQLKRKVAGLMKESEELHRYRRDIDWLKTLQKKVVKDRFD |
| Ga0315277_101395783 | 3300032118 | Sediment | MSESVEQLKRKVAGLMKESEELHRFRRDIDWLKTLQKKVVKDRFD |
| Ga0315268_100176872 | 3300032173 | Sediment | MSEAVEQLKRKVASLAKESEELQRFKRDVDWLKTLQKKLVRDGFD |
| Ga0315268_108093753 | 3300032173 | Sediment | MSETVEQLKRRVASLARESEELQRYKRDIDWLKTQQKKLVRDGVD |
| Ga0316624_121787892 | 3300033486 | Soil | MDDSVEQLKRKVANLMKDSEDLTRFRKDIDWLKTIQK |
| Ga0316628_1006628291 | 3300033513 | Soil | VSFVADMTESVEQLKRKVAGLMKESEELRRFRKDIDWLKTLQKKVVKDKFD |
| Ga0316628_1010846251 | 3300033513 | Soil | MVVVFFVVDMDESVEQIKRKVAGLMKDSEDLNRFRKDIDWLKTIQKKVVKAKFD |
| Ga0373900_000921_1188_1322 | 3300034078 | Sediment Slurry | MDDVEHIRRKVASLMKESEELQRYKKDLDWLRTLQKKLVKERLD |
| Ga0373900_049539_494_640 | 3300034078 | Sediment Slurry | VDEMTEALEQLKRKVANLKQESEELQRYKKDIDWLKTLQKKLVKDGFD |
| Ga0373900_058745_197_334 | 3300034078 | Sediment Slurry | MGESVEQLKRKVAGLMKESEDLNRFRKDIDWLKTLQKKVVKDKFD |
| Ga0373901_097079_466_603 | 3300034083 | Sediment Slurry | MSEAVEQLKRKVASLMKESEELQRYGKDIEWLKTLRKKLAKNGFD |
| Ga0373902_088531_334_495 | 3300034099 | Sediment Slurry | MRVFFVVAMSESVEQLKRKVASLMKESEELKRFRKDIDWLKTLQKKVVKDRFD |
| Ga0373902_117650_494_613 | 3300034099 | Sediment Slurry | MRFVVVMSESVEQLKRKVASLMRESEELKRFRKDIDWLKT |
| Ga0373902_175535_1_138 | 3300034099 | Sediment Slurry | MTEALEQLKRKVANLKQESEELQRYKKDIDWLKTLQKKLVKDGFD |
| Ga0373909_0144715_60_197 | 3300034191 | Sediment Slurry | MGEAVEQLKRKVASLMKESEELQRYKKDLDWLRTLQKKLVKERLD |
| ⦗Top⦘ |