| Basic Information | |
|---|---|
| Family ID | F101983 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VTLYFFERITDDDFIGPVIVAAPDEATAWTLLAGRERSDVEALKTL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 48.04 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.157 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.706 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.431 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.62% β-sheet: 22.97% Coil/Unstructured: 55.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 9.80 |
| PF00501 | AMP-binding | 5.88 |
| PF13046 | DUF3906 | 1.96 |
| PF13103 | TonB_2 | 0.98 |
| PF00005 | ABC_tran | 0.98 |
| PF00892 | EamA | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 9.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.16 % |
| Unclassified | root | N/A | 7.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0746764 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 2228664022|INPgaii200_c1079608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 644 | Open in IMG/M |
| 3300000890|JGI11643J12802_11535712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300000956|JGI10216J12902_100682332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 570 | Open in IMG/M |
| 3300000956|JGI10216J12902_120956168 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
| 3300002122|C687J26623_10189918 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300002562|JGI25382J37095_10135926 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 819 | Open in IMG/M |
| 3300002912|JGI25386J43895_10015290 | Not Available | 2232 | Open in IMG/M |
| 3300004157|Ga0062590_101506501 | Not Available | 675 | Open in IMG/M |
| 3300005181|Ga0066678_10285777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1076 | Open in IMG/M |
| 3300005186|Ga0066676_10045380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 2473 | Open in IMG/M |
| 3300005294|Ga0065705_10247586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1207 | Open in IMG/M |
| 3300005294|Ga0065705_10489802 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 788 | Open in IMG/M |
| 3300005295|Ga0065707_10662154 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 657 | Open in IMG/M |
| 3300005353|Ga0070669_101290383 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005446|Ga0066686_10003898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 6865 | Open in IMG/M |
| 3300005467|Ga0070706_100067027 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3320 | Open in IMG/M |
| 3300005558|Ga0066698_10008756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 5419 | Open in IMG/M |
| 3300005574|Ga0066694_10120088 | Not Available | 1236 | Open in IMG/M |
| 3300005578|Ga0068854_101681970 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300005615|Ga0070702_101044059 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
| 3300005615|Ga0070702_101852361 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300005718|Ga0068866_10408499 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005764|Ga0066903_101082958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1475 | Open in IMG/M |
| 3300005764|Ga0066903_108662506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300006058|Ga0075432_10132921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 944 | Open in IMG/M |
| 3300006163|Ga0070715_10102727 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1336 | Open in IMG/M |
| 3300006844|Ga0075428_102128447 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300006847|Ga0075431_101557424 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
| 3300006854|Ga0075425_102623851 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300006969|Ga0075419_11533266 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300007255|Ga0099791_10326166 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
| 3300009100|Ga0075418_12396068 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300009156|Ga0111538_13215559 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300009162|Ga0075423_10365739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1513 | Open in IMG/M |
| 3300009553|Ga0105249_10405894 | Not Available | 1394 | Open in IMG/M |
| 3300009807|Ga0105061_1055577 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300009815|Ga0105070_1041462 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300009820|Ga0105085_1055985 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010029|Ga0105074_1079213 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010046|Ga0126384_10447334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1102 | Open in IMG/M |
| 3300010329|Ga0134111_10009107 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3131 | Open in IMG/M |
| 3300010335|Ga0134063_10282139 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 796 | Open in IMG/M |
| 3300010359|Ga0126376_11957205 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 627 | Open in IMG/M |
| 3300010361|Ga0126378_13332582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300010362|Ga0126377_10412259 | Not Available | 1365 | Open in IMG/M |
| 3300010366|Ga0126379_10687192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1116 | Open in IMG/M |
| 3300010401|Ga0134121_12961559 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 522 | Open in IMG/M |
| 3300012198|Ga0137364_11175344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 575 | Open in IMG/M |
| 3300012199|Ga0137383_10144256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1742 | Open in IMG/M |
| 3300012205|Ga0137362_11197547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 644 | Open in IMG/M |
| 3300012206|Ga0137380_10881912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 769 | Open in IMG/M |
| 3300012209|Ga0137379_10513200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1107 | Open in IMG/M |
| 3300012349|Ga0137387_11229876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300012353|Ga0137367_10076208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2483 | Open in IMG/M |
| 3300012356|Ga0137371_10925367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 663 | Open in IMG/M |
| 3300012922|Ga0137394_11286883 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300012930|Ga0137407_11668572 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012930|Ga0137407_11734745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
| 3300012944|Ga0137410_11773695 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300012948|Ga0126375_10362677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1033 | Open in IMG/M |
| 3300014965|Ga0120193_10061327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 574 | Open in IMG/M |
| 3300015371|Ga0132258_11012306 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2100 | Open in IMG/M |
| 3300017656|Ga0134112_10123969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 982 | Open in IMG/M |
| 3300018076|Ga0184609_10247888 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300018422|Ga0190265_12491654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 616 | Open in IMG/M |
| 3300020170|Ga0179594_10144125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 879 | Open in IMG/M |
| 3300020215|Ga0196963_10363714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
| 3300025930|Ga0207701_11479829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
| 3300026089|Ga0207648_12207722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 511 | Open in IMG/M |
| 3300026326|Ga0209801_1150995 | Not Available | 979 | Open in IMG/M |
| 3300026360|Ga0257173_1024455 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 774 | Open in IMG/M |
| 3300026480|Ga0257177_1007349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1392 | Open in IMG/M |
| 3300026524|Ga0209690_1176265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 718 | Open in IMG/M |
| 3300026537|Ga0209157_1002455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14780 | Open in IMG/M |
| 3300027490|Ga0209899_1030553 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1172 | Open in IMG/M |
| 3300027511|Ga0209843_1054987 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300027646|Ga0209466_1092338 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
| 3300027654|Ga0209799_1123736 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
| 3300027695|Ga0209966_1044115 | Not Available | 936 | Open in IMG/M |
| 3300027874|Ga0209465_10587361 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
| 3300027880|Ga0209481_10632030 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300027903|Ga0209488_10438109 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 963 | Open in IMG/M |
| 3300027909|Ga0209382_11374084 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 711 | Open in IMG/M |
| 3300027909|Ga0209382_11821208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 592 | Open in IMG/M |
| 3300031152|Ga0307501_10172780 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1049567 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1006 | Open in IMG/M |
| 3300031561|Ga0318528_10447594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
| 3300031719|Ga0306917_10254957 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1345 | Open in IMG/M |
| 3300031740|Ga0307468_100556082 | Not Available | 925 | Open in IMG/M |
| 3300031780|Ga0318508_1047793 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1125 | Open in IMG/M |
| 3300031795|Ga0318557_10404374 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300031820|Ga0307473_10020885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2664 | Open in IMG/M |
| 3300031820|Ga0307473_11261568 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
| 3300031910|Ga0306923_10418478 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1523 | Open in IMG/M |
| 3300031912|Ga0306921_12211778 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300031944|Ga0310884_10033175 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2201 | Open in IMG/M |
| 3300032025|Ga0318507_10009229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3171 | Open in IMG/M |
| 3300032059|Ga0318533_10303801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1158 | Open in IMG/M |
| 3300032091|Ga0318577_10413934 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300032180|Ga0307471_103244701 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300032205|Ga0307472_100716946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 902 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.75% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.98% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_07467643 | 2228664021 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAAAWTVLATRERSDVETLKTLGWQIAQDLAVLPAR |
| INPgaii200_10796083 | 2228664022 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAAAWNVLASRERADVEALKTLGWQIAQDLAAVPA |
| JGI11643J12802_115357122 | 3300000890 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAAAWTVLATRERSDVET |
| JGI10216J12902_1006823322 | 3300000956 | Soil | VTLYFFERMTDDDFIGPVIVAAASEDEAWRLLAARERSARPALETLGW |
| JGI10216J12902_1209561683 | 3300000956 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAAAWNVLASRERADVEALKTLGW |
| C687J26623_101899183 | 3300002122 | Soil | VTLYFFERITEDDFVGPVIVAAPSEDEAWTLLAQRERQDAEALRALGWQIAQDLATLPS |
| JGI25382J37095_101359263 | 3300002562 | Grasslands Soil | VTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQDLAAIP |
| JGI25386J43895_100152901 | 3300002912 | Grasslands Soil | VTLYFFERITDDDFIGPVIVAAPSEDEAWRLLAARERSQRPALEALGWQIAQDLAAMPAR |
| Ga0062590_1015065013 | 3300004157 | Soil | VTLYFFERITDDDFIGPVIAAAPSEDEAWRLLATREQSERGALE |
| Ga0066678_102857771 | 3300005181 | Soil | VTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKA |
| Ga0066676_100453805 | 3300005186 | Soil | VTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKALGWQIAQDLTAVPSR |
| Ga0065705_102475863 | 3300005294 | Switchgrass Rhizosphere | VTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEALKTLGW |
| Ga0065705_104898023 | 3300005294 | Switchgrass Rhizosphere | VTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARERTEIDALKSLGWQIAQD |
| Ga0065707_106621543 | 3300005295 | Switchgrass Rhizosphere | VTLYFFERITDDDFIGPVIVAAPDEAVAWTVLATRERSDVETLKTLGWQIAQDLAVLPAR |
| Ga0070669_1012903832 | 3300005353 | Switchgrass Rhizosphere | VTLYFFERIADDDFIGPVIVAAPDEATAWTVLAQRERSDVEALKTLGWQIA |
| Ga0066686_100038988 | 3300005446 | Soil | VTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKALGWQIAQDLT |
| Ga0070706_1000670271 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLYFFERITEDDFIGPVIVAAGSEDEAWRLLAARERSARPALE |
| Ga0066698_100087567 | 3300005558 | Soil | VTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKALGWQIAQDLTAVPS |
| Ga0066694_101200881 | 3300005574 | Soil | VTLYFFERITENDFIGPVIVAAPSEDEAWALLASRERSER |
| Ga0068854_1016819703 | 3300005578 | Corn Rhizosphere | VTLYFFERITDDDFIGPVIVAAASEDEAWRLLAARE |
| Ga0070702_1010440593 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEALKTLGWQIAQDLAA |
| Ga0070702_1018523611 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MILYFFERITDDDFIGPVIAAAADEDEAWRLLAQREKQEVDALKDLGWQIAQD |
| Ga0068866_104084993 | 3300005718 | Miscanthus Rhizosphere | MTLYFFERITDDDFIGPVIAAAGNEDEAWRLLAQREKQEVAALKDLGWQIAQ |
| Ga0066903_1010829584 | 3300005764 | Tropical Forest Soil | VTLYFFERITDDDFIGPVIVAASDEAEAWAVLATRERAEEEALKTLGWQIAQDLAALPSR |
| Ga0066903_1086625061 | 3300005764 | Tropical Forest Soil | VTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEA |
| Ga0075432_101329211 | 3300006058 | Populus Rhizosphere | VTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARERAEIDALKTLGWQIAQDL |
| Ga0070715_101027273 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLYFFERITDDDFIGPVIVAAPDEAAAWTLLAARERSEVEALKTLGWQIAQDL |
| Ga0075428_1021284473 | 3300006844 | Populus Rhizosphere | MTLYFFERITDNDFVGPVIVAASSEDEAWALLAARERSERAALETLGWQIAQDLA |
| Ga0075431_1015574243 | 3300006847 | Populus Rhizosphere | VTLYFFERITDDDFIGPVIVAAASEDEAWRLLAARERSARPALE |
| Ga0075425_1026238513 | 3300006854 | Populus Rhizosphere | VTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEALKTLGWQIAQDLA |
| Ga0075419_115332661 | 3300006969 | Populus Rhizosphere | VILYFFERISEDDFIGPVIVAAGDEHEAWLVLARRERDAVESLKSLGWQI |
| Ga0099791_103261661 | 3300007255 | Vadose Zone Soil | VTLYFFERVTDDDFIGPVIVAAPDEATAWTVLAQRERSDVEALKTLGWQIAQDLA |
| Ga0075418_123960681 | 3300009100 | Populus Rhizosphere | VILYFFERISEDDFIGPVIVAAPDEAAAWIVLAQRERSDVDAL |
| Ga0111538_132155593 | 3300009156 | Populus Rhizosphere | VTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARERTEIDAL |
| Ga0075423_103657394 | 3300009162 | Populus Rhizosphere | VTLYFFERISDDDFIGPVIVAAPSEEEAWRLLAGRERSEV |
| Ga0105249_104058941 | 3300009553 | Switchgrass Rhizosphere | VILYFFERISEDDFIGPVIVAAGDEHEAWLVLARRERDAVESLKSLGWQIVQELTSWPSR |
| Ga0105061_10555772 | 3300009807 | Groundwater Sand | MTLYFFERITDNDFIGPVIVAAPDETTAWDLLAARERADVEALKTLGW |
| Ga0105070_10414622 | 3300009815 | Groundwater Sand | MTLYFFERITDNDFIGPVIVAAPDETTAWDLLAARERADVEAL |
| Ga0105085_10559851 | 3300009820 | Groundwater Sand | MTLYFFERITDNDFIGPVIVAAPDETTAWDLLAARERAD |
| Ga0105074_10792132 | 3300010029 | Groundwater Sand | MTLYFFERITDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQI |
| Ga0126384_104473341 | 3300010046 | Tropical Forest Soil | VTLYFFERISDDDFIGPVIVAAPDEATAWSLLAGREKADVEALKTLGWQ |
| Ga0134111_100091071 | 3300010329 | Grasslands Soil | VTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALK |
| Ga0134063_102821392 | 3300010335 | Grasslands Soil | FERITDDDFIGPVIVAAPDEATAWTLLATRERSDVEAL* |
| Ga0126376_119572051 | 3300010359 | Tropical Forest Soil | VILYFFERITDDDFIGPVIVAAPDEAAAWTVLASRERAEVEALRTLGWQIAQDLAALPSR |
| Ga0126378_133325821 | 3300010361 | Tropical Forest Soil | VTLYFFERITDDDFIGPVIVAAPDEVAAWTLLASRERSDVESLKAIG |
| Ga0126377_104122591 | 3300010362 | Tropical Forest Soil | VTLYFFERITDDDFIGPVIVAAASEDEAWRLLAARERSARPALETLGWQIAQDLAAIP |
| Ga0126379_106871923 | 3300010366 | Tropical Forest Soil | VTLYFFERITDDDFIGPVIVAAPDEATAWTVLASR |
| Ga0134121_129615592 | 3300010401 | Terrestrial Soil | VTLYFFERITDDDFIGPVIAAAADEEEAWRLLAQREKQEVDALK |
| Ga0137364_111753443 | 3300012198 | Vadose Zone Soil | MTLYFFERITDDDFIGPVIVAAASDDEAWRLLAGRERCERAALEALGWQ |
| Ga0137383_101442561 | 3300012199 | Vadose Zone Soil | VTLYFFERITEDDFIGPVIVAAPDESTAWTLLATRERSDVE |
| Ga0137362_111975471 | 3300012205 | Vadose Zone Soil | VTLYFFERITDDDFIGPVIVAAPSEDEAWRLLAARERSQRPALEALGWQIAQDLAAM |
| Ga0137380_108819121 | 3300012206 | Vadose Zone Soil | VTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERADVDALKALGWQIAQD |
| Ga0137379_105132001 | 3300012209 | Vadose Zone Soil | VTLYFFERITDDDFIGPVIVAAPSEDEAWRLLAARERSQRPALEALGWQ |
| Ga0137387_112298761 | 3300012349 | Vadose Zone Soil | VTLYFFERITDDDFIGPVIVAAPDEATAWSLLAGREKSDVEALKTLG |
| Ga0137367_100762085 | 3300012353 | Vadose Zone Soil | VTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTL |
| Ga0137371_109253671 | 3300012356 | Vadose Zone Soil | VKLYFFERITAEDFIGPIIVAAGDETEAWTLLSRREGQSVQA |
| Ga0137394_112868831 | 3300012922 | Vadose Zone Soil | VTLYFFERITEDDFIGPVIVAAPSEDEAWRLLAARERSERP |
| Ga0137407_116685721 | 3300012930 | Vadose Zone Soil | VTLYFFERISDDDFIGPVIVAAPDEAAAWTALASRE |
| Ga0137407_117347453 | 3300012930 | Vadose Zone Soil | VTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGR |
| Ga0137410_117736951 | 3300012944 | Vadose Zone Soil | VTLYFFERIADDDFIGPVIVAAPDEPTAWSLLAGRERADVEALKTLGW |
| Ga0126375_103626773 | 3300012948 | Tropical Forest Soil | VTLYFFERITDDDFIGPVIVAAASEDEAWRLLAGRERTARPALEALGWQRGHTFRWRKSG |
| Ga0120193_100613273 | 3300014965 | Terrestrial | MTLYFFERITDDDFIGPVIVAAPDEAGAWTLLAGRER |
| Ga0132258_110123061 | 3300015371 | Arabidopsis Rhizosphere | VTLYFFERITDDDFIGPVIVAAPDEATAWTALASRERSEVEA |
| Ga0134112_101239693 | 3300017656 | Grasslands Soil | VTLYFFERITDDDFIGPVIAAAASEDEAWRLLAARERSQRPALEALGWQIAQDL |
| Ga0184609_102478882 | 3300018076 | Groundwater Sediment | MTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQELTA |
| Ga0190265_124916541 | 3300018422 | Soil | VTLYFFERITDDDFIGPVIVAAPSEDDAWTLLAKREGSDRAALEALGWQIAQDLAAIPA |
| Ga0179594_101441253 | 3300020170 | Vadose Zone Soil | VTLYFFERITDDDFIGPVIVAAPSEDEAWRLLAARERSERPALEAVGWQIAQDLAAMPAR |
| Ga0196963_103637142 | 3300020215 | Soil | MTLYFFERITDDDFIGPVIVAAASEGDAWGLLATREGSDRAALEALGWQIAQDLAAIPS |
| Ga0207701_114798291 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VTLYFFERITDDDFIGPVIVAAPDEPTAWSLLAGREKSDVEALKTLGWQIAQDLAAVPAR |
| Ga0207648_122077222 | 3300026089 | Miscanthus Rhizosphere | VTLYFFERIADDDFIGPVIVAAPDEATAWTVLAQRERSDVEALKTLGWQIAQDL |
| Ga0209801_11509951 | 3300026326 | Soil | VTLYFFERIADDDFIGPVIVAAPDETTAWGLLAGRERA |
| Ga0257173_10244551 | 3300026360 | Soil | VTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQDLAAIPPR |
| Ga0257177_10073493 | 3300026480 | Soil | VTLYFFERITDDDFIGPVIVAAPDEATAWTLLAGRERSDVE |
| Ga0209690_11762651 | 3300026524 | Soil | VTLYFFERITDDDFIGPVIVAAPDEATAWTLLATRERSDV |
| Ga0209157_10024551 | 3300026537 | Soil | VTLYFFERVADDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQDL |
| Ga0209899_10305533 | 3300027490 | Groundwater Sand | MTLYFFERITDNDFIGPVIVAAPDETTAWDLLAARERADVEALKTLGWQIAQDLAAIPPR |
| Ga0209843_10549871 | 3300027511 | Groundwater Sand | MTLYFFERITDDDFIGPVIVAAPDEATAWSLLAGRERSDVEALKTLGWQIAQDLAAI |
| Ga0209466_10923381 | 3300027646 | Tropical Forest Soil | VTLYFFERITDDDFIGPVIVAAPDEATAWTVLASRERSDVEALKTLGWQIAQDLAAIPSR |
| Ga0209799_11237361 | 3300027654 | Tropical Forest Soil | VILYFFERITDDDFIGPVIVAAPDEAAAWTVLATRERAEVEALRTLGWQIAQDLAALPS |
| Ga0209966_10441151 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MTLYFFERITDNDFVGPVIVAASSEDEAWALLAARER |
| Ga0209465_105873613 | 3300027874 | Tropical Forest Soil | VTLYFFERISADDFIGPVIVAAPDEATAWSLLAGRE |
| Ga0209481_106320301 | 3300027880 | Populus Rhizosphere | VTLYFFERITDDDFIGPVIVAAASEDEAWGLLAARERSQRPALEALGW |
| Ga0209488_104381093 | 3300027903 | Vadose Zone Soil | VTLYFFERVTDDDFIGPVIVAAPDEATAWSLLAGRERSDVEAFA |
| Ga0209382_113740843 | 3300027909 | Populus Rhizosphere | VTLYFFERITDDDFIGPVIVAAPDEAAAWTVLATRERSDAETLKTL |
| Ga0209382_118212083 | 3300027909 | Populus Rhizosphere | VTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARE |
| Ga0307501_101727802 | 3300031152 | Soil | VTLYFFERISDDDFIGPVIVAAPDEAAAWTALASRERSEVEA |
| (restricted) Ga0255312_10495671 | 3300031248 | Sandy Soil | VTLYFFERITDDDFIGPVIVAAPDEATAWTLLAGRERSDVEALKTL |
| Ga0318528_104475941 | 3300031561 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTLGWQIAQDLAAMPSR |
| Ga0306917_102549571 | 3300031719 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTLGWQI |
| Ga0307468_1005560823 | 3300031740 | Hardwood Forest Soil | MILYFFERITDDDFIGPVIAAAADEDEAWRLLAQREKQAVDALKDLGWQIAQDLAALP |
| Ga0318508_10477933 | 3300031780 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTLGWQ |
| Ga0318557_104043741 | 3300031795 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALR |
| Ga0307473_100208851 | 3300031820 | Hardwood Forest Soil | MTLYFFERITDDDFIGPVIAAAGDEDEAWRLLAQREKQEVDALKDLGWQIAQDLAA |
| Ga0307473_112615681 | 3300031820 | Hardwood Forest Soil | VTLYFFERISDDDFIGPVIVAAPDEATAWSLLAGREKSDVEALKTLGWQIAQDLAAV |
| Ga0306923_104184781 | 3300031910 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERR |
| Ga0306921_122117781 | 3300031912 | Soil | VILYFFERISEDDFIGPVIVAAGDEREAWLVLARREGGAVESLKSLGWQIAQDL |
| Ga0310884_100331754 | 3300031944 | Soil | VTLYFFERISDDDFIGPVIVAAPDEATAWTVLAARERSEVDALKTLGWQI |
| Ga0318507_100092296 | 3300032025 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRER |
| Ga0318533_103038011 | 3300032059 | Soil | VTLYFFERITDDDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTLGWQIAQ |
| Ga0318577_104139341 | 3300032091 | Soil | VTLYFFERITDNDFIGPVIVAAPDEAEAWAVLASRERRDVEALRTL |
| Ga0307471_1032447013 | 3300032180 | Hardwood Forest Soil | VTLYFFERITDDDFIGPVIVAAPDEATAWSLLAGREKSDAEALKTLGWQIAQDLAAVPV |
| Ga0307472_1007169461 | 3300032205 | Hardwood Forest Soil | VTLYFFERISEDDFIGPVIIAAGDENEAWRRLARREGDAVESLKALGWQIAQDLAGL |
| ⦗Top⦘ |