| Basic Information | |
|---|---|
| Family ID | F101982 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTELAGVLTSRLQALWGTAVEVTAVRPLPGGASRESWDVRV |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 71.57 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 91.18 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.549 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.294 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 18.84% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01061 | ABC2_membrane | 34.31 |
| PF01544 | CorA | 9.80 |
| PF12698 | ABC2_membrane_3 | 5.88 |
| PF04909 | Amidohydro_2 | 3.92 |
| PF00271 | Helicase_C | 2.94 |
| PF00005 | ABC_tran | 2.94 |
| PF01179 | Cu_amine_oxid | 1.96 |
| PF00781 | DAGK_cat | 1.96 |
| PF00270 | DEAD | 1.96 |
| PF02909 | TetR_C_1 | 1.96 |
| PF13193 | AMP-binding_C | 0.98 |
| PF13032 | RNaseH_pPIWI_RE | 0.98 |
| PF02589 | LUD_dom | 0.98 |
| PF01327 | Pep_deformylase | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF00291 | PALP | 0.98 |
| PF08241 | Methyltransf_11 | 0.98 |
| PF13673 | Acetyltransf_10 | 0.98 |
| PF13460 | NAD_binding_10 | 0.98 |
| PF02720 | DUF222 | 0.98 |
| PF13354 | Beta-lactamase2 | 0.98 |
| PF02771 | Acyl-CoA_dh_N | 0.98 |
| PF12323 | HTH_OrfB_IS605 | 0.98 |
| PF04075 | F420H2_quin_red | 0.98 |
| PF00583 | Acetyltransf_1 | 0.98 |
| PF08223 | PaaX_C | 0.98 |
| PF01790 | LGT | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 9.80 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 3.92 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 1.96 |
| COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.96 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.98 |
| COG3327 | DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation) | Transcription [K] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.53 % |
| Unclassified | root | N/A | 26.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10471971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10343709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300005164|Ga0066815_10014044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1036 | Open in IMG/M |
| 3300005332|Ga0066388_104570320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300005434|Ga0070709_10208104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1389 | Open in IMG/M |
| 3300005436|Ga0070713_101348463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300005436|Ga0070713_102318237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300005456|Ga0070678_100255758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1470 | Open in IMG/M |
| 3300005471|Ga0070698_101065016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 757 | Open in IMG/M |
| 3300005564|Ga0070664_101737002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
| 3300005587|Ga0066654_10680272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300005610|Ga0070763_10113935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1378 | Open in IMG/M |
| 3300005610|Ga0070763_10549515 | Not Available | 665 | Open in IMG/M |
| 3300005719|Ga0068861_100502266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1097 | Open in IMG/M |
| 3300005921|Ga0070766_10277499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1070 | Open in IMG/M |
| 3300006028|Ga0070717_10000920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 19586 | Open in IMG/M |
| 3300006163|Ga0070715_10108551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1306 | Open in IMG/M |
| 3300006871|Ga0075434_100913844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
| 3300006881|Ga0068865_101758965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300006954|Ga0079219_10072826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1580 | Open in IMG/M |
| 3300006954|Ga0079219_11793957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300009521|Ga0116222_1274583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 728 | Open in IMG/M |
| 3300009545|Ga0105237_12572029 | Not Available | 520 | Open in IMG/M |
| 3300010046|Ga0126384_11199350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
| 3300010366|Ga0126379_11950647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300010876|Ga0126361_10992607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4807 | Open in IMG/M |
| 3300012951|Ga0164300_10165373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1051 | Open in IMG/M |
| 3300013307|Ga0157372_13375599 | Not Available | 508 | Open in IMG/M |
| 3300016371|Ga0182034_10659954 | Not Available | 887 | Open in IMG/M |
| 3300016387|Ga0182040_11251802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
| 3300016422|Ga0182039_10161667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1748 | Open in IMG/M |
| 3300017792|Ga0163161_10291480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1283 | Open in IMG/M |
| 3300017942|Ga0187808_10145770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1042 | Open in IMG/M |
| 3300017942|Ga0187808_10332482 | Not Available | 688 | Open in IMG/M |
| 3300017973|Ga0187780_10378719 | Not Available | 1002 | Open in IMG/M |
| 3300017975|Ga0187782_10213865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1444 | Open in IMG/M |
| 3300018085|Ga0187772_10596694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 785 | Open in IMG/M |
| 3300020583|Ga0210401_10100999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2710 | Open in IMG/M |
| 3300021171|Ga0210405_10332066 | Not Available | 1200 | Open in IMG/M |
| 3300021180|Ga0210396_10201625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1778 | Open in IMG/M |
| 3300021180|Ga0210396_11078816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
| 3300021477|Ga0210398_10624774 | Not Available | 874 | Open in IMG/M |
| 3300021478|Ga0210402_10191193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1878 | Open in IMG/M |
| 3300021479|Ga0210410_10388586 | Not Available | 1250 | Open in IMG/M |
| 3300025898|Ga0207692_10649409 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300025916|Ga0207663_11551270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 533 | Open in IMG/M |
| 3300025928|Ga0207700_10950771 | Not Available | 769 | Open in IMG/M |
| 3300026118|Ga0207675_102468658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
| 3300026356|Ga0257150_1032656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300026557|Ga0179587_10408088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium → Cellulosimicrobium marinum | 886 | Open in IMG/M |
| 3300027073|Ga0208366_1033840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas stutzeri group → Pseudomonas stutzeri subgroup → Pseudomonas stutzeri | 572 | Open in IMG/M |
| 3300027523|Ga0208890_1027607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
| 3300027570|Ga0208043_1052607 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1187 | Open in IMG/M |
| 3300027767|Ga0209655_10048023 | Not Available | 1426 | Open in IMG/M |
| 3300027889|Ga0209380_10265192 | Not Available | 1009 | Open in IMG/M |
| 3300027905|Ga0209415_10457161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica → Pseudonocardia asaccharolytica DSM 44247 = NBRC 16224 | 1002 | Open in IMG/M |
| 3300028906|Ga0308309_11042030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 708 | Open in IMG/M |
| 3300031090|Ga0265760_10238619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
| 3300031152|Ga0307501_10224451 | Not Available | 548 | Open in IMG/M |
| 3300031543|Ga0318516_10063010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2043 | Open in IMG/M |
| 3300031543|Ga0318516_10132028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1428 | Open in IMG/M |
| 3300031545|Ga0318541_10497611 | Not Available | 682 | Open in IMG/M |
| 3300031573|Ga0310915_10208393 | Not Available | 1368 | Open in IMG/M |
| 3300031573|Ga0310915_10583880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
| 3300031640|Ga0318555_10131445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1334 | Open in IMG/M |
| 3300031680|Ga0318574_10611424 | Not Available | 639 | Open in IMG/M |
| 3300031681|Ga0318572_10136324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1411 | Open in IMG/M |
| 3300031708|Ga0310686_118723928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1627 | Open in IMG/M |
| 3300031715|Ga0307476_11415138 | Not Available | 506 | Open in IMG/M |
| 3300031718|Ga0307474_11463624 | Not Available | 538 | Open in IMG/M |
| 3300031719|Ga0306917_10049687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2816 | Open in IMG/M |
| 3300031719|Ga0306917_11045354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
| 3300031723|Ga0318493_10075128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1655 | Open in IMG/M |
| 3300031723|Ga0318493_10837556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300031736|Ga0318501_10739644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300031748|Ga0318492_10015471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3217 | Open in IMG/M |
| 3300031751|Ga0318494_10697573 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031769|Ga0318526_10458995 | Not Available | 520 | Open in IMG/M |
| 3300031782|Ga0318552_10232678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae | 934 | Open in IMG/M |
| 3300031797|Ga0318550_10324912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
| 3300031798|Ga0318523_10021273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2829 | Open in IMG/M |
| 3300031832|Ga0318499_10135327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 960 | Open in IMG/M |
| 3300031835|Ga0318517_10206887 | Not Available | 884 | Open in IMG/M |
| 3300031846|Ga0318512_10174305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1045 | Open in IMG/M |
| 3300031910|Ga0306923_12317439 | Not Available | 535 | Open in IMG/M |
| 3300031938|Ga0308175_103124283 | Not Available | 514 | Open in IMG/M |
| 3300031954|Ga0306926_12093756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300032001|Ga0306922_10359220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1562 | Open in IMG/M |
| 3300032010|Ga0318569_10305476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300032035|Ga0310911_10819151 | Not Available | 538 | Open in IMG/M |
| 3300032039|Ga0318559_10380207 | Not Available | 658 | Open in IMG/M |
| 3300032052|Ga0318506_10131236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1089 | Open in IMG/M |
| 3300032068|Ga0318553_10351532 | Not Available | 771 | Open in IMG/M |
| 3300032089|Ga0318525_10177315 | Not Available | 1095 | Open in IMG/M |
| 3300032089|Ga0318525_10425665 | Not Available | 680 | Open in IMG/M |
| 3300032091|Ga0318577_10237800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
| 3300032160|Ga0311301_10791748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1305 | Open in IMG/M |
| 3300032770|Ga0335085_10098121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3795 | Open in IMG/M |
| 3300032783|Ga0335079_12132249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300032828|Ga0335080_10864676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Promicromonosporaceae → Cellulosimicrobium → Cellulosimicrobium marinum | 930 | Open in IMG/M |
| 3300033158|Ga0335077_10195876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2276 | Open in IMG/M |
| 3300033158|Ga0335077_11141170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_104719711 | 3300001867 | Forest Soil | MTELAGVLTSRLRALWGPAVEVTAVRPLPGGASRESWDVLVRLAG |
| JGIcombinedJ51221_103437092 | 3300003505 | Forest Soil | MTEASGLASVLAARLRALWDAQVEVTGVRPLPGGASRESWDVRVRTAGAAHLP |
| Ga0066815_100140443 | 3300005164 | Soil | MTELAGALTSRLRALWGPAAEVTAVRPLPGGASRESWDIRVRLDSDG |
| Ga0066388_1045703201 | 3300005332 | Tropical Forest Soil | MTELAGVLTSQLQALWETDVEVTAVRPLPGGASRESWDVR |
| Ga0070709_102081041 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVTEPPGLAGVLASRLAALWGMQADVTGVRPLAGGASRESWDVR |
| Ga0070713_1013484631 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTELAGALTSRLRTLWGPAVAVTEVRPMPGGASRESWDVRVRTG |
| Ga0070713_1023182371 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGVLTSRLQALWGPAVEVSAVRPMPGGASRESWDIEVQTPG |
| Ga0070678_1002557583 | 3300005456 | Miscanthus Rhizosphere | MTELADILTERLQALWGPAVEVSAVRPMPGGASRESWDIEVQTPG |
| Ga0070698_1010650162 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTELAGALTSRLRTLWGPAIEVTEVRPMPGGASRESWHVRVRASDGAE |
| Ga0070664_1017370022 | 3300005564 | Corn Rhizosphere | MTELAGVLTSRLRTLWGPAVAVTEVRPMPGGASRESWDVRVRTEG |
| Ga0066654_106802722 | 3300005587 | Soil | MTELADILTERLRALWGTAVTVSAVRPMPGGASRESWDI |
| Ga0070763_101139351 | 3300005610 | Soil | MTEASGLASALASRLRALWGTEAAVTGVRPLPGGASRE |
| Ga0070763_105495151 | 3300005610 | Soil | MTETSGLASALAARLGALWGTQAEVTGVRPLPGGASRESW |
| Ga0068861_1005022661 | 3300005719 | Switchgrass Rhizosphere | MTELADILTERLQALWGPAVEVSAVRPMPGGASRESWD |
| Ga0070766_102774991 | 3300005921 | Soil | MTEASGLASALTSRLRALWGTEAAVTGVRPLPGGASRESWDV |
| Ga0070717_100009201 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTELAGVLTSRLQALWGTAVEVTAVRPLPGGASRESWDVRV |
| Ga0070715_101085511 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTELAGALTSRLRTLWGPAVEVTEVRPMPGGASRESWDVRVR |
| Ga0075434_1009138441 | 3300006871 | Populus Rhizosphere | MTELAGALTSRLRTLWGPAVAVTEVRPMPGGASRESWDVRV |
| Ga0068865_1017589651 | 3300006881 | Miscanthus Rhizosphere | MTELAGVLTARLRTLWGPAVEVSAVRPMPGGASRESWDI |
| Ga0079219_100728263 | 3300006954 | Agricultural Soil | MTELADILTARLQALWGPAVEVSAVRPMPGGASRESW |
| Ga0079219_117939572 | 3300006954 | Agricultural Soil | MTELAGALTSRLRTLWDPAVEVSAVRPMPGGASRESWDIEV |
| Ga0116222_12745832 | 3300009521 | Peatlands Soil | MTEASGLTSALASRLGALWSTEVEVTGLRPLPGGASRESWDV |
| Ga0105237_125720291 | 3300009545 | Corn Rhizosphere | MTELAGVLTSRLRTLWGPAVEVSAVRPMPGGASRE |
| Ga0126384_111993501 | 3300010046 | Tropical Forest Soil | MTELAGILTERLRALWGPAVTVGAVRPMPGGASRESWDIEVQTPGQA |
| Ga0126379_119506471 | 3300010366 | Tropical Forest Soil | MTELADVLASSLQALWETDVEVIGLRQLAGGASRESWDVR |
| Ga0126361_109926071 | 3300010876 | Boreal Forest Soil | MTETPGLASALESRLQALWGTEAAVTGVRPLPGGASRESWDFRV |
| Ga0164300_101653733 | 3300012951 | Soil | MTELADILTERLQALWGPAVEVSAVRPMPGGASRESWDIEVQ |
| Ga0157372_133755991 | 3300013307 | Corn Rhizosphere | MTEMAGVLTSRLQALWGPAVEVSAVRPMPGGASRESWDIEVQTPG |
| Ga0182034_106599541 | 3300016371 | Soil | MTEASGLASALASRVRALWGTEAEVTGVRPLPGGASRESWDVRVR |
| Ga0182040_112518021 | 3300016387 | Soil | MTGPSGLADALASRLRALWGTEVQVTGVRLVPGGASRESW |
| Ga0182039_101616674 | 3300016422 | Soil | MTETSALTSALASRLRVLWGTEAQVIGIRLLPGGASRESWDVQLRTSDGTERRLILL |
| Ga0163161_102914801 | 3300017792 | Switchgrass Rhizosphere | MTELADILTERLQALWGPAVEVSAVRPMPGGASRESWDIEVQTP |
| Ga0187808_101457703 | 3300017942 | Freshwater Sediment | MEPAGQTRPAAAGLASTLASRLRALWGTEAEVTGVRPLPGGASRESWDVR |
| Ga0187808_103324821 | 3300017942 | Freshwater Sediment | MTEASGLAGALASRLGALWGTQVEVSGLRALPGGASRESWD |
| Ga0187780_103787193 | 3300017973 | Tropical Peatland | MTEAQGLAGALASRLRTLWGTEAEVTGVRPLPGGASRESW |
| Ga0187782_102138651 | 3300017975 | Tropical Peatland | MTEASGLASALSSRLRALWGTQVEVTGVRPLPGGASRESWDVRVRAAGDA |
| Ga0187772_105966942 | 3300018085 | Tropical Peatland | MTGASGLASVLTSRLRALWGTEAEVTGIRPLPGGASRESWDVRVR |
| Ga0210401_101009995 | 3300020583 | Soil | MTEASGLASALASRLQALWGTEAAATGVRPLPGGASR |
| Ga0210405_103320661 | 3300021171 | Soil | MTEASGLASALASRLQALWGTEAAITGVRPLPGGA |
| Ga0210396_102016251 | 3300021180 | Soil | MTELAGALTSRLEALWGPAVAVAEVRPMPGGASRESWDV |
| Ga0210396_110788161 | 3300021180 | Soil | MTAASGLASVLTSRLQALWGTAVEVTGVRPLPGGASRESWDVQARTPSDAQADDTQASYP |
| Ga0210398_106247741 | 3300021477 | Soil | MTEASGLASALASRLQALWGTEAAATGVRPLPGGASRESWDVRVRTAGGAERRL |
| Ga0210402_101911931 | 3300021478 | Soil | MTELAGALTSRLRTLWGPAVDVTEVRPMPGGASRESWDVR |
| Ga0210410_103885861 | 3300021479 | Soil | MTEASGLASALASRLQTLWGTEATVTGVRPLPGGASRESWDVQVRTA |
| Ga0207692_106494091 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTELADILTERLQALWGPAVEVSAVRPMPGGASRESWDIGVRGPGQA |
| Ga0207663_115512701 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGVLTSRLQALWGPAVEVSAVRPMPGGASRESWDIEVQTPGEAQRHL |
| Ga0207700_109507712 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTELAGALTSRLRTLWGPAVAVTEVRPMPGGASRESW |
| Ga0207675_1024686581 | 3300026118 | Switchgrass Rhizosphere | MTELAGVLTSRLRTLWGPAVEVSAVRPMPGGASRESWDIEVRRPGQAQHH |
| Ga0257150_10326561 | 3300026356 | Soil | MTEASGLASALASRLQALWGTEAAVTGVRPLPGGASRESWDVRVRTAGG |
| Ga0179587_104080881 | 3300026557 | Vadose Zone Soil | MTELAGVLTSRLRTLWGPAVEATEVRPMPGGASRESWEVRVRLAG |
| Ga0208366_10338401 | 3300027073 | Forest Soil | MTEAPGLASALASRLQALWGTEAAVTGVRPLPGGASRESWDVR |
| Ga0208890_10276072 | 3300027523 | Soil | MTELAGVLTSRLQALWGTAVEVTAVRPLPGGASRESWDVRVRTAG |
| Ga0208043_10526072 | 3300027570 | Peatlands Soil | MTGVSGLASVLAPRLRALWGAEAEVTDVRPLPGGASRESWGIRVRTAG |
| Ga0209655_100480231 | 3300027767 | Bog Forest Soil | MMTEASGLASALASRLQAVWGTEAAVTGVRPLPGG |
| Ga0209380_102651921 | 3300027889 | Soil | MTEASGLASALTSRLRALWGTEAAVTGVRPLPGGASRECW |
| Ga0209415_104571611 | 3300027905 | Peatlands Soil | MTGASGLASALASRLQALWGTEAAVTGVRPLPGGASRESWDVRVRMASGA |
| Ga0308309_110420301 | 3300028906 | Soil | MTEASGLASALASRLRALWGTEAAVTGVRPLPGGASRESWDVRVRTAGGAER |
| Ga0265760_102386191 | 3300031090 | Soil | MTEASGLASALASRLRALWGTEAAVTGVRPLPGGA |
| Ga0307501_102244512 | 3300031152 | Soil | MTELAGVLTSRLRTLWGPAVEVSAVRPMPGGASRESWDIEVHR |
| Ga0318516_100630101 | 3300031543 | Soil | MVMTEASGLADALASRLRALWGTDVEVTGLRQLSGGASRESWDIGV |
| Ga0318516_101320281 | 3300031543 | Soil | MTGPSGLADALASRLRALWGTEVQVTGVRLVPGGASRESWDVRVRTAGDAQRR |
| Ga0318541_104976113 | 3300031545 | Soil | MTEASGLASVLASRLRALWGTEAEVAEIRLLPGGASRESWDVRV |
| Ga0310915_102083934 | 3300031573 | Soil | MTEASGLASVLASRLRALWGTEAEVAEIRLLPGGASRESWDVRVRTAGDAQL |
| Ga0310915_105838801 | 3300031573 | Soil | MTDLAGVLTSRLQAIWGPAVEVTAIRPLPGGASRESWDVRVRLAGPGLAG |
| Ga0318555_101314452 | 3300031640 | Soil | MTGPSGLADALASRLRALWGTEVQVTGVRLVPGGASRESWDVR |
| Ga0318574_106114243 | 3300031680 | Soil | MTEASGLASVLASRLRALWGTEAEVAEIRLLPGGASRESWDVRVRTAGDAQLP |
| Ga0318572_101363241 | 3300031681 | Soil | MTGPSELADALASRLRALWGTEVQVTGVRLVPGGASRESRHHRRYRI |
| Ga0310686_1187239282 | 3300031708 | Soil | MTGTSGLASALASRLQTLWGTEAQVASVRPLPGGASR |
| Ga0307476_114151382 | 3300031715 | Hardwood Forest Soil | MTELAGALTSRLRTLWGPAVAVTEVRPMPGGASRESWDVRVRASNG |
| Ga0307474_114636242 | 3300031718 | Hardwood Forest Soil | MTELAGALTSRLRTLWGPAVAVTEVRPMPGGASRESWDV |
| Ga0306917_100496875 | 3300031719 | Soil | MTETSALTSALASRLRVLWGTEAQVIGIRLLSGGASRE |
| Ga0306917_110453542 | 3300031719 | Soil | MTDLAGVLTSRLQALWGPAVEVTEVRPMPGGASRESWDVGVRAAD |
| Ga0318493_100751283 | 3300031723 | Soil | MTDLAGVLTSRLQAIWGPAVEVTAIRPLPGGASRESWDVRVRLAG |
| Ga0318493_108375562 | 3300031723 | Soil | MTDLAGALTLRLQSLWGPAVEVISVRPLPGGASRES |
| Ga0318501_107396442 | 3300031736 | Soil | MTELAGVLTARLQALWGPAVEVTAIRPMPGGASRESWDVRVRTGDPGGTERH |
| Ga0318492_100154711 | 3300031748 | Soil | MTGPSRLADALASRLRALWGTEVQVTGVRLVPGGASRESRHHRRYRI |
| Ga0318494_106975731 | 3300031751 | Soil | MTEASGLASALASRLRALWGTEAEVTGVRPLPGGASRESWD |
| Ga0318526_104589951 | 3300031769 | Soil | MIEASGLASALASRLRALWGTETEVTGVRPLASRSR |
| Ga0318552_102326781 | 3300031782 | Soil | MTELAGVLASRLHALWGTAVEVTAVRPLPGGASRESWDVRVRLADGLAGEG |
| Ga0318550_103249122 | 3300031797 | Soil | MTELAGVLTSRLQALWGTAVEVTAVRPLPGGASRESWDVRVRTEGGTE |
| Ga0318523_100212734 | 3300031798 | Soil | MTELAGVLTSRLQALWGTAVEVTAVRPLPGGASRESWDVRVRTEGGTERRLI |
| Ga0318499_101353272 | 3300031832 | Soil | MVMTEASGLADALASRLRALWGTDVEVTGLRQLSGGASRESWDIGVRTAGESERR |
| Ga0318517_102068873 | 3300031835 | Soil | MTEASGLASVLASRLRALWGTEAEVAEIRLLPGGASRESWDVRVRTAG |
| Ga0318512_101743051 | 3300031846 | Soil | MTELAGVLASRLHALWGTAVEVTAVRPLPGGASRESWDVR |
| Ga0306923_123174391 | 3300031910 | Soil | MTEASGLASALASRLRALWGTEAEVTGVRPLPGGAS |
| Ga0308175_1031242831 | 3300031938 | Soil | MTELAGVLTSRLQTLWGPAVEVTAVRPMPGGASRESWDIE |
| Ga0306926_120937561 | 3300031954 | Soil | MTETAGLASALASRLRALWDTEAEVTGVGLLPGGASRESWDVRVRTAGGA |
| Ga0306922_103592203 | 3300032001 | Soil | MTELAGVLASRLHALWGTAVEVTAVRPLPGGASRESWDVRV |
| Ga0318569_103054762 | 3300032010 | Soil | MTDLAGVLTSRLQAIWGPAVEVTAIRPLPGGASRESWDVRVRLAGPGLA |
| Ga0310911_108191512 | 3300032035 | Soil | MTEASGLASALASRVRALWGTEAEVTGVRPLPGGASRESWDVRVRTAGDARL |
| Ga0318559_103802071 | 3300032039 | Soil | MIEASGLASALASRLRALWGTETEVTGVRPLPGGASRESWDVRVRTAGDAHLPV |
| Ga0318506_101312362 | 3300032052 | Soil | MTGPSGLADALASRLRALWGTEVQVTGVRLVPGGASRES |
| Ga0318553_103515321 | 3300032068 | Soil | MTEASGLASVLASRLRALWGTEAEVAEIRLLPGGASRESWDVRVRTAGDAQLPVA |
| Ga0318525_101773151 | 3300032089 | Soil | MTEASGLASVLASRLRALWGTEAEVAEIRLLPGGASRESWDVRVRTAGDAQLPV |
| Ga0318525_104256651 | 3300032089 | Soil | MTETSGLASALASRLRALWDTEAEVTGVGLLPGGASRESWDVRVRTAAGA |
| Ga0318577_102378002 | 3300032091 | Soil | MTELAGVLASRLHALWGTAVEVTAVRPLPGGASRES |
| Ga0311301_107917481 | 3300032160 | Peatlands Soil | MTETSGLASALAARLGALWGTQAEVTGVRPLPGGASRESWDVRVRMAGDA |
| Ga0335085_100981211 | 3300032770 | Soil | MTELAGVLTSRLQALWGPAVEVTAIRPLPGGASRESWDVRVRLAG |
| Ga0335079_121322492 | 3300032783 | Soil | MTELAGALTSRLRALWGPAVEVTAVRPLPGGASRESWDVRVRLAGE |
| Ga0335080_108646762 | 3300032828 | Soil | MTELAGLLTSRLRALWSTAAEVTAVRPLPGGASRESWDVRVRLTG |
| Ga0335077_101958764 | 3300033158 | Soil | MTEASGLADMLASRLRVLCGTDVEVTGLRQLSGGASRESWDIRVRTAGQTERR |
| Ga0335077_111411701 | 3300033158 | Soil | MTELAGVLTSRLQALWGPAVEVTAIRPLPGGASRESWDVR |
| ⦗Top⦘ |