NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101972

Metagenome / Metatranscriptome Family F101972

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101972
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 45 residues
Representative Sequence VGAGGPIVFNQWHNSTGAFEAAKYVNGNLVLVGSVSAAQIAALSR
Number of Associated Samples 97
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.98 %
% of genes near scaffold ends (potentially truncated) 99.02 %
% of genes from short scaffolds (< 2000 bps) 90.20 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.372 % of family members)
Environment Ontology (ENVO) Unclassified
(26.471 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.078 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.59%    β-sheet: 20.55%    Coil/Unstructured: 69.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF02653BPD_transp_2 91.18
PF12399BCA_ABC_TP_C 1.96
PF07729FCD 0.98
PF01738DLH 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.98
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001648|JGI20242J16303_107073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300002075|JGI24738J21930_10118639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300005187|Ga0066675_10663119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia784Open in IMG/M
3300005332|Ga0066388_103266020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia828Open in IMG/M
3300005332|Ga0066388_103671376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia783Open in IMG/M
3300005332|Ga0066388_107728759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300005334|Ga0068869_100020274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium vaccae4557Open in IMG/M
3300005365|Ga0070688_100084033All Organisms → cellular organisms → Bacteria2067Open in IMG/M
3300005467|Ga0070706_100795339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia875Open in IMG/M
3300005534|Ga0070735_10848877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300005554|Ga0066661_10550186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300005560|Ga0066670_10208032All Organisms → cellular organisms → Bacteria1177Open in IMG/M
3300005610|Ga0070763_10775028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300005764|Ga0066903_102174716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1069Open in IMG/M
3300005921|Ga0070766_11229593All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006041|Ga0075023_100029594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum1599Open in IMG/M
3300006163|Ga0070715_10231282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia956Open in IMG/M
3300006174|Ga0075014_100041171All Organisms → cellular organisms → Bacteria1934Open in IMG/M
3300006175|Ga0070712_100623287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum915Open in IMG/M
3300006176|Ga0070765_100445817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum1212Open in IMG/M
3300006176|Ga0070765_101419106All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300006354|Ga0075021_10179472All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300006852|Ga0075433_10150180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum2072Open in IMG/M
3300010048|Ga0126373_12514216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300010321|Ga0134067_10257197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300010358|Ga0126370_10682801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia899Open in IMG/M
3300010366|Ga0126379_11719412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300010376|Ga0126381_103607597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300010398|Ga0126383_12444759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300010866|Ga0126344_1001256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia679Open in IMG/M
3300011270|Ga0137391_10084766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae2735Open in IMG/M
3300011271|Ga0137393_10372590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1221Open in IMG/M
3300012096|Ga0137389_11511396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300012202|Ga0137363_10185175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum1660Open in IMG/M
3300012363|Ga0137390_11325637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia665Open in IMG/M
3300012377|Ga0134029_1055565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia747Open in IMG/M
3300012387|Ga0134030_1269516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia762Open in IMG/M
3300012406|Ga0134053_1141897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia624Open in IMG/M
3300012685|Ga0137397_10251554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum1317Open in IMG/M
3300012957|Ga0164303_10379887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia865Open in IMG/M
3300012988|Ga0164306_10297898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1176Open in IMG/M
3300015241|Ga0137418_10441671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1053Open in IMG/M
3300016270|Ga0182036_10363806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1118Open in IMG/M
3300016371|Ga0182034_10570334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia952Open in IMG/M
3300016404|Ga0182037_11498308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300017821|Ga0187812_1165739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300017936|Ga0187821_10422945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300017942|Ga0187808_10610504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300019890|Ga0193728_1361246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300020582|Ga0210395_11119053All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M
3300021180|Ga0210396_10098914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2640Open in IMG/M
3300021401|Ga0210393_10915623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia711Open in IMG/M
3300021402|Ga0210385_10285074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1221Open in IMG/M
3300021444|Ga0213878_10046986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1679Open in IMG/M
3300021475|Ga0210392_10235977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1290Open in IMG/M
3300021478|Ga0210402_10634201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia989Open in IMG/M
3300021560|Ga0126371_12368795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia642Open in IMG/M
3300021861|Ga0213853_10099121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300022713|Ga0242677_1053371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300022724|Ga0242665_10159094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300024245|Ga0247677_1047340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia626Open in IMG/M
3300024279|Ga0247692_1021614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia981Open in IMG/M
3300024331|Ga0247668_1003972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3217Open in IMG/M
3300025905|Ga0207685_10180504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia978Open in IMG/M
3300025910|Ga0207684_11742614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300025926|Ga0207659_10060081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2735Open in IMG/M
3300026309|Ga0209055_1234869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300027703|Ga0207862_1032265All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300027857|Ga0209166_10146801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1289Open in IMG/M
3300027882|Ga0209590_10012318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum4062Open in IMG/M
3300027894|Ga0209068_10646030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300029701|Ga0222748_1031875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia830Open in IMG/M
3300030738|Ga0265462_11112348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300031018|Ga0265773_1045705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300031231|Ga0170824_104289254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia908Open in IMG/M
3300031446|Ga0170820_12341607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia675Open in IMG/M
3300031549|Ga0318571_10001391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4237Open in IMG/M
3300031549|Ga0318571_10290057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300031672|Ga0307373_10144682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1870Open in IMG/M
3300031682|Ga0318560_10355608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia791Open in IMG/M
3300031736|Ga0318501_10409514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia733Open in IMG/M
3300031753|Ga0307477_10898244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia585Open in IMG/M
3300031764|Ga0318535_10074631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Ferrimicrobium → Ferrimicrobium acidiphilum1455Open in IMG/M
3300031764|Ga0318535_10426198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia591Open in IMG/M
3300031771|Ga0318546_10415282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia940Open in IMG/M
3300031781|Ga0318547_10537277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia723Open in IMG/M
3300031797|Ga0318550_10198954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia969Open in IMG/M
3300031823|Ga0307478_10822394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia778Open in IMG/M
3300031880|Ga0318544_10091468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1140Open in IMG/M
3300031912|Ga0306921_10021767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7048Open in IMG/M
3300031945|Ga0310913_10502471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia861Open in IMG/M
3300031947|Ga0310909_10273406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1413Open in IMG/M
3300031954|Ga0306926_12729318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300031996|Ga0308176_12122807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia600Open in IMG/M
3300032001|Ga0306922_11862690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300032052|Ga0318506_10439109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300032060|Ga0318505_10206123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300032064|Ga0318510_10444529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M
3300032068|Ga0318553_10137835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1259Open in IMG/M
3300032091|Ga0318577_10153522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1096Open in IMG/M
3300032094|Ga0318540_10453527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300033289|Ga0310914_10526283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1069Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.37%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.90%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.98%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001648Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008EnvironmentalOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012377Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012387Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012406Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300031018Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031672Soil microbial communities from Risofladan, Vaasa, Finland - OX-2EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20242J16303_10707323300001648Forest SoilVFTQSHNSTGAFEAAKYVSGNLVLVGAVSAAQIAAISK*
JGI24738J21930_1011863923300002075Corn RhizosphereWHNSTGAFEAVKDVNGNPVLVGSVSAAQIAAISR*
Ga0066675_1066311913300005187SoilGGPIVFNQSHNSTGAFEAAKYVNGNLVLVGAVSAAQIAALSR*
Ga0066388_10326602013300005332Tropical Forest SoilIVFNHWHNSTGAFEAARYVNGNLVLVGSVSAAQIAAISR*
Ga0066388_10367137613300005332Tropical Forest SoilQIQYVGAGGPIVFNQWHNSTGAFEAAKYLKGNPVIVGSVSAAQIASLSR*
Ga0066388_10772875913300005332Tropical Forest SoilKQIQYVGAGGPIAFNQWHNSTGAFEAAKYVKGGPVLVGSVSAAQIATLSR*
Ga0068869_10002027463300005334Miscanthus RhizospherePIVFDQWHNSTGAFEAVKDVNGNPVLVGSVSAAQIAAISR*
Ga0070688_10008403313300005365Switchgrass RhizosphereALAAGKQIQYVGAGGPIVFNQSHNSTGAFEAAKYVNGNLVLVGSVSAAQIAAISR*
Ga0070706_10079533923300005467Corn, Switchgrass And Miscanthus RhizosphereGKQIQYVGAGGPIVFDHWHSSTGAFEAAKYVNGNPVLVGSVSAAQIAAISR*
Ga0070735_1084887713300005534Surface SoilQAGKQIQYLGAGGPIVFNHWHNSTGAFEAAKYVKGNPVLVGSVTAAQIAALSR*
Ga0066661_1055018613300005554SoilHWHNSTGAFEAAKYAKGNPVLVGSVSAAQIAALSR*
Ga0066670_1020803213300005560SoilQYVGAGGPIVFDQWHNSTGAFEAAKYVNGNLVLVGSVSAAQIAAISR*
Ga0070763_1077502823300005610SoilSHNSTGAFEAAKYVSGNVDLVGSVTAAQIAAISK*
Ga0066903_10217471613300005764Tropical Forest SoilGGSIVFNRWHNSTGAFEAARYLNGNPSLVGSVSAAQIAAISR*
Ga0070766_1122959313300005921SoilAGKQIQYVGAGGPIVFTKSHNSTGAFEAAKYVSGNLVLVGAVSAAQIAAISK*
Ga0075023_10002959413300006041WatershedsQIQYVGAGGPIVFNQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAAISK*
Ga0070715_1023128223300006163Corn, Switchgrass And Miscanthus RhizosphereQIQYIGAGGPIAFNQWHNSTGAFEAAKYVKGSPVLVGSVSAAQIASLSR*
Ga0075014_10004117133300006174WatershedsQYVGAGGPIVFNQWHNSTGAFEAAKYVNGNLVVVGSVTAAQIAAISK*
Ga0070712_10062328713300006175Corn, Switchgrass And Miscanthus RhizosphereGKQIQYVGAGGPIVFNHWHNSTGAFEAAKYVKGNPVLVGSVSAAQIATLSR*
Ga0070765_10044581713300006176SoilGAGGPIVFNHWHNSTGAFEAARYVKGNPVLVGSVSAAQIAALSR*
Ga0070765_10141910613300006176SoilQQIQYVGAGGPIVFNRWHNSTGAFEAARYMQGNIVLVGSVSAAQIAALSR*
Ga0075021_1017947213300006354WatershedsQYVGAGGPIVFNQSHNSTGAFEAAKYVNGNLVLVGSVSAAQIAAISR*
Ga0075433_1015018033300006852Populus RhizosphereQWHNSTGAFEAVKDVNGNPVLVGSVSAAQIAAISR*
Ga0126373_1251421613300010048Tropical Forest SoilGPIVFDQWHNSTGAFEAAKYVSGNQVLVGSVSAAQIAALSG*
Ga0134067_1025719713300010321Grasslands SoilLAAGKQIQYVGAGGPIVFDQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAAISR*
Ga0126370_1068280113300010358Tropical Forest SoilGAGGPIVFNQWHNSTGAFEAAKFLKGNISLVGSVSAAQIAAISK*
Ga0126379_1171941213300010366Tropical Forest SoilGGPIVFNQWHNSTGAFEAAKYLKGNPVIVGSVSAAQIASLSR*
Ga0126381_10360759713300010376Tropical Forest SoilALKAGKQIQYVGAGGPIVFNRWRNSTGAFEAAKYLKGNPVIVGSVSAAQISSLSR*
Ga0126383_1244475913300010398Tropical Forest SoilQWHNSTGAFEAARYVNGNLALVGSVSAAQIAALSR*
Ga0126344_100125613300010866Boreal Forest SoilNHWHNSTGAFEAAKYTKGNLTLVGSVSAAQIATISR*
Ga0137391_1008476643300011270Vadose Zone SoilWHNSTGAFEAARYVNGNLALVGSVSAAQIAAISR*
Ga0137393_1037259013300011271Vadose Zone SoilIQYVGAGGPIVFNRGHNSTGAFEAARYVNGKLVLVGSVSAAQIAAISR*
Ga0137389_1151139613300012096Vadose Zone SoilIQYVGAGGPIVFNRWDNSTGPFQGGRYANGKLALVGSVSAAQIAAISR*
Ga0137363_1018517513300012202Vadose Zone SoilAGKHIQYVGAGGPIVFNQSHNSTGAFEAAKYVNGNLVLVGSVSAAQIAAISR*
Ga0137390_1132563713300012363Vadose Zone SoilAAGKAALQAGKQIQYVGAGGPIVFDHWHNSTGAFEAAKYVKGNPVLVGSVSAAQIATLSR
Ga0134029_105556523300012377Grasslands SoilWHNSTGAFEAAKYVNGNPVLVGSVSAAQIAAISR*
Ga0134030_126951623300012387Grasslands SoilGGPIVFNQSHNSTGAFEAAKYVNGNLVLVGSVSAAQIAALSR*
Ga0134053_114189713300012406Grasslands SoilAAGKQIQYVGAGGPIVFDQWHNSTGAFEAAKQVDGNPVLVGSVSAAQIAAISR*
Ga0137397_1025155433300012685Vadose Zone SoilAALGAGKPIQYVGAGGPIVFNQSHNSTGSFAAAKYVNGKLVLVGSVSAAQIAAISR*
Ga0164303_1037988713300012957SoilGGAGGPIVFVQWHNSTGACEAVKDVNGNDVLVGSVSAAQIAAISR*
Ga0164306_1029789833300012988SoilPIVFNQSHNSTGAFEAAKYVNGNLVLVGAVSAAQIAAISR*
Ga0137418_1044167113300015241Vadose Zone SoilPIVFNRWHNSTGAFEAARYVNGKLVLVGSVSAAQIAAMSR*
Ga0182036_1036380623300016270SoilAGGPIVFNQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAALSG
Ga0182034_1057033423300016371SoilPIVFNQWHNSTGAFEAAKYLKGNPVIVGSVSAAQIASLSR
Ga0182037_1149830823300016404SoilFNKWHNSTGAFEVAGYLAPGKIRLAGTVSAAAIAALSGR
Ga0187812_116573923300017821Freshwater SedimentVFNQWHNSTGAFEAAKYVSGNVDLVGSVTAAQIAAISK
Ga0187821_1042294513300017936Freshwater SedimentIVFSQWHNSTGAFEAARYVNGNVVLVGSVSAAQIAGISR
Ga0187808_1061050423300017942Freshwater SedimentQYVGAGGPIVFNQSHNSTGAFEAAKYVSGNLVLVGAVSAAQIAAISR
Ga0193728_136124623300019890SoilFTAGRAALQADKQIQYVGAGGPIVFNHWHNSTGAFEAAKYVKGNPVLVGSVSAAQIAELS
Ga0210395_1111905313300020582SoilQIQYVGAGGPIVFNQWHNSTGAFEAAKYVSGNLDLVGSVTAAQIAAISK
Ga0210396_1009891443300021180SoilQIQYVGAGGAIVFNRWHNSTGAFEAARYVQGNVKLVGAVSAAQIAAISR
Ga0210393_1091562323300021401SoilGGPIVFNTSHNSTGAFEAAKYVSGNLVLAGSITAAQIAALSQ
Ga0210385_1028507433300021402SoilGRIVLTKSHNSTGAFEAAKYVSGNLVLVGAVSAAQIAAIAK
Ga0213878_1004698613300021444Bulk SoilDAGKQIQYVGAGGPIVFNEWHNSTGAFEAAKYESGNVDLVGSVSAAQIAALNR
Ga0210392_1023597733300021475SoilIQYVGAGGPIVFNHWHNSTGAFEAAKYVKGNPVLVGSVSAAQIAALSR
Ga0210402_1063420123300021478SoilAGKQIQYAGAGGPIVFNHWHNSTGAFEAARYVNGNLVLVGSVSAAQIAALSR
Ga0126371_1236879513300021560Tropical Forest SoilKAALLAGKQIQYVGAGGPIVFNQWHNSTGAFEAAKYVKGNPVLVGSVSAAQIATLSR
Ga0213853_1009912113300021861WatershedsALAAGKQIQYVGAGGPIVFTKSHNSTGAFEAAKYVSGNLVLVGAVSAAQIAAISR
Ga0242677_105337123300022713SoilYVGAGGPIVFNTSHNSTGAFEAAKYVSGNLVLAGSITAAQIAALSQ
Ga0242665_1015909423300022724SoilGPIVFDQSHNSTGAFEAAKYVNGNLVLVGSVSAAQIAAISR
Ga0247677_104734013300024245SoilIVFDQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAAISR
Ga0247692_102161413300024279SoilLAAGKQIQYVGAGGPIVFDQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAAISR
Ga0247668_100397213300024331SoilFDQWHNSTGAFEAVKDVNGNPVLVGSVSAAQIAAISR
Ga0207685_1018050423300025905Corn, Switchgrass And Miscanthus RhizosphereQIQYIGAGGPIAFNQWHNSTGAFEAAKYVKGSPVLVGSVSAAQIASLSR
Ga0207684_1174261413300025910Corn, Switchgrass And Miscanthus RhizosphereYVGAGGPIVFDHWHSSTGAFEAAKYVNGNPVLVGSVSAAQIAAISR
Ga0207659_1006008143300025926Miscanthus RhizosphereDQWHNSTGAFEAVKDVNGNPVLVGSVSAAQIAAISR
Ga0209055_123486913300026309SoilQIQYVGAGGPIVFDKWHNSTGAFEAAKYVNGNVALVGSVSAAQIAGISR
Ga0207862_103226523300027703Tropical Forest SoilVGAGGPIVFNQWHNSTGAFEAAKYVNGNLVLVGSVSAAQIAALSR
Ga0209166_1014680113300027857Surface SoilGAGGAIVFNTWHNSTGAFEAAKYVNGNPVLVGSVSAAQIAAISK
Ga0209590_1001231813300027882Vadose Zone SoilYVGAGGPIVFNHWHNSTGAFEAARYVKGNLVLVGSVSAAQIAALSR
Ga0209068_1064603013300027894WatershedsGKQVQYVGAGGPIVFNQSHNSTGAFEAAKYVNGNLVLVGAVSAAQIAAISK
Ga0222748_103187513300029701SoilGGPIVFTKSHNSTGAFEAAKYVSGNLVLVGAVTAAQIAAIAK
Ga0265462_1111234823300030738SoilGKQVQYVGAGGPIVFTPSHNSTGAFEAAQYVSGNVVLVGAVSAAQIAAISK
Ga0265773_104570523300031018SoilAAGKQIQYVGAGGPIVFTKSHNSTGAFEAAKYVSGNLVLVGAVSAAQIAAISK
Ga0170824_10428925413300031231Forest SoilKSHNSTGAFEAAKYVNGKLVLVGAVSAAQIAAISR
Ga0170820_1234160723300031446Forest SoilVQYVGAGGPIVFSKSHNSTGAFEAAKYVNGKLVLVGAVSAAQIAAISR
Ga0318571_1000139113300031549SoilKALQEGKQIQYVGAGGPIVFNRWHNSTGAFEAARYLNGNPSLVGSVSAAQIAAISR
Ga0318571_1029005713300031549SoilFNQWHNSTGAFEAAKYLKGNPAIVGSVSAAQIASLSR
Ga0307373_1014468233300031672SoilAGGPIVFNGWHNSTGAFEAAKYVHHRLVLVGSVSALQIAKLSH
Ga0318560_1035560813300031682SoilQEGKQIQYVGAGGPIVFNHWHNSTGAFEAARYLKGNPVLVGSVSAAQIAAISR
Ga0318501_1040951423300031736SoilYVGAGGPIVFNQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAALSG
Ga0307477_1089824413300031753Hardwood Forest SoilGGPIAFNQWHNSTGAFEAARYVKGSPVLVGSVSAAQIASLSR
Ga0318535_1007463133300031764SoilYVGAGGPIVFNQWHNSTGAFEAAKYLKGNPVIVGSVSAAQIASLSR
Ga0318535_1042619823300031764SoilALLAGKQIQYVGAGGPIVFNQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAALSG
Ga0318546_1041528223300031771SoilPIVFNQWHNSTGAFEAAKYVGGNQVLVGSVSAAQIAALSG
Ga0318547_1053727713300031781SoilFNQWHNSTGAFEAAKYVKGNPVLIGSVSAAQIATLSR
Ga0318550_1019895413300031797SoilAGGPIVFDHWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAAISG
Ga0307478_1082239423300031823Hardwood Forest SoilPIVFNHWHNSTGAFEAAKYVKGNPVLVGSVTAAQIAALSR
Ga0318544_1009146813300031880SoilIQYVGAGGPIVFNQWHNSTGAFEAAKYLKGNPAIVGSVSAAQIASLSR
Ga0306921_1002176713300031912SoilVGAGGPIVFNQWHNSTGAFEAAKYLKGNPAIVGSVSAAQIASLSR
Ga0310913_1050247113300031945SoilIQYVGAGGPIVFNQWHNSTGAFEAAKYLKGTPVIVGSVSAAQIASLSR
Ga0310909_1027340613300031947SoilVGAGGPIVFNRWHNSTGAFEAARYLNGNPSLVGSVSAAQIAAISR
Ga0306926_1272931813300031954SoilQIQYVGAGGPIVFNQWHNSTGAFEAAKYLKGNPVIVGSVSAAQIASLSR
Ga0308176_1212280723300031996SoilGKQIQYVGAGGPIVFDKSHNSTGAFEAAKYVNGNLVLVGAVSAAQIAAISR
Ga0306922_1186269013300032001SoilAGGPIVFDQWHNSTGAFEAAKYVKGNPVLVGSVSAAQIATLSR
Ga0318506_1043910923300032052SoilGAGGPIVFNQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAALSG
Ga0318505_1020612313300032060SoilNQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAALSG
Ga0318510_1044452923300032064SoilLQEGKQIQYVGAGGPIVFNRWHNSTGAFEAARYLNGNPSLVGSVSAAQIAAISR
Ga0318553_1013783513300032068SoilAGKQIQYVGAGGPIVFNQWHNSTGAFEAAKYLKGNPVIVGSVSAAQIASLSR
Ga0318577_1015352213300032091SoilVFDQWHNSTGAFEAAKDVNGNPVLVGSVSAAQIAAISR
Ga0318540_1045352723300032094SoilQWHNSTGAFEAAKYLKGTPVIVGSVSAAQIASLSR
Ga0310914_1052628323300033289SoilGKQIQYVGAGGPIVFDQWHNSTGAFEAAKYVKGNPVLVGSVSAAQIAAISR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.