| Basic Information | |
|---|---|
| Family ID | F101946 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSKPPRRLRRSCPHDGADLLRDALGQFICEICGQPCEDEPPDAGAEP |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 57.84 % |
| % of genes near scaffold ends (potentially truncated) | 31.37 % |
| % of genes from short scaffolds (< 2000 bps) | 95.10 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.627 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (9.804 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.137 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.67% β-sheet: 0.00% Coil/Unstructured: 77.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF03640 | Lipoprotein_15 | 1.96 |
| PF02803 | Thiolase_C | 0.98 |
| PF07690 | MFS_1 | 0.98 |
| PF13520 | AA_permease_2 | 0.98 |
| PF07920 | DUF1684 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 1.96 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.98 |
| COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.63 % |
| Unclassified | root | N/A | 31.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|F0B48LX02IJ87Z | Not Available | 514 | Open in IMG/M |
| 3300003659|JGI25404J52841_10013949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1743 | Open in IMG/M |
| 3300004114|Ga0062593_100567445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1072 | Open in IMG/M |
| 3300005329|Ga0070683_100204676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1875 | Open in IMG/M |
| 3300005434|Ga0070709_10528863 | Not Available | 899 | Open in IMG/M |
| 3300005435|Ga0070714_101133713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
| 3300005435|Ga0070714_101878716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 584 | Open in IMG/M |
| 3300005436|Ga0070713_102065894 | Not Available | 552 | Open in IMG/M |
| 3300005439|Ga0070711_100533030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 972 | Open in IMG/M |
| 3300005439|Ga0070711_100699349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 853 | Open in IMG/M |
| 3300005441|Ga0070700_100248151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1275 | Open in IMG/M |
| 3300005535|Ga0070684_100213538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1759 | Open in IMG/M |
| 3300005537|Ga0070730_10550502 | Not Available | 739 | Open in IMG/M |
| 3300005543|Ga0070672_101065920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 718 | Open in IMG/M |
| 3300006163|Ga0070715_10583556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300006175|Ga0070712_100144580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1819 | Open in IMG/M |
| 3300006755|Ga0079222_10925778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300006791|Ga0066653_10375628 | Not Available | 725 | Open in IMG/M |
| 3300006804|Ga0079221_10108691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1378 | Open in IMG/M |
| 3300006806|Ga0079220_10233243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1088 | Open in IMG/M |
| 3300006914|Ga0075436_100132765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1747 | Open in IMG/M |
| 3300009011|Ga0105251_10103640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1300 | Open in IMG/M |
| 3300009176|Ga0105242_10521904 | Not Available | 1133 | Open in IMG/M |
| 3300010043|Ga0126380_10154204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1476 | Open in IMG/M |
| 3300010152|Ga0126318_10280497 | Not Available | 570 | Open in IMG/M |
| 3300010154|Ga0127503_11057116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 640 | Open in IMG/M |
| 3300010325|Ga0134064_10286526 | Not Available | 622 | Open in IMG/M |
| 3300010337|Ga0134062_10156854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1016 | Open in IMG/M |
| 3300010359|Ga0126376_11552119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300010373|Ga0134128_10666211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1156 | Open in IMG/M |
| 3300010373|Ga0134128_11933572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 649 | Open in IMG/M |
| 3300010375|Ga0105239_12174189 | Not Available | 645 | Open in IMG/M |
| 3300010396|Ga0134126_12029359 | Not Available | 629 | Open in IMG/M |
| 3300010396|Ga0134126_13087946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 502 | Open in IMG/M |
| 3300010860|Ga0126351_1004699 | Not Available | 517 | Open in IMG/M |
| 3300010861|Ga0126349_1155011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1000 | Open in IMG/M |
| 3300010861|Ga0126349_1256887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 815 | Open in IMG/M |
| 3300012201|Ga0137365_10056136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2975 | Open in IMG/M |
| 3300012206|Ga0137380_10197916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1823 | Open in IMG/M |
| 3300012207|Ga0137381_10406781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1187 | Open in IMG/M |
| 3300012489|Ga0157349_1020112 | Not Available | 624 | Open in IMG/M |
| 3300012495|Ga0157323_1022153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300012501|Ga0157351_1005651 | Not Available | 1010 | Open in IMG/M |
| 3300012927|Ga0137416_10679443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 903 | Open in IMG/M |
| 3300012929|Ga0137404_10646125 | Not Available | 954 | Open in IMG/M |
| 3300012930|Ga0137407_10146839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2080 | Open in IMG/M |
| 3300012958|Ga0164299_10178267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1206 | Open in IMG/M |
| 3300012958|Ga0164299_10446386 | Not Available | 845 | Open in IMG/M |
| 3300012961|Ga0164302_10319573 | Not Available | 1023 | Open in IMG/M |
| 3300012977|Ga0134087_10641781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300013104|Ga0157370_10524140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1087 | Open in IMG/M |
| 3300013296|Ga0157374_10290716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1615 | Open in IMG/M |
| 3300014487|Ga0182000_10235679 | Not Available | 724 | Open in IMG/M |
| 3300014968|Ga0157379_11979911 | Not Available | 575 | Open in IMG/M |
| 3300015245|Ga0137409_10428886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1140 | Open in IMG/M |
| 3300016341|Ga0182035_11927530 | Not Available | 536 | Open in IMG/M |
| 3300016445|Ga0182038_12133828 | Not Available | 508 | Open in IMG/M |
| 3300018482|Ga0066669_11200557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 685 | Open in IMG/M |
| 3300019361|Ga0173482_10030993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1614 | Open in IMG/M |
| 3300020000|Ga0193692_1074899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300020062|Ga0193724_1089998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
| 3300020070|Ga0206356_11430845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1271 | Open in IMG/M |
| 3300020581|Ga0210399_10686462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300021374|Ga0213881_10205166 | Not Available | 871 | Open in IMG/M |
| 3300021560|Ga0126371_10233063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1950 | Open in IMG/M |
| 3300022724|Ga0242665_10364318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 520 | Open in IMG/M |
| 3300024283|Ga0247670_1018601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1244 | Open in IMG/M |
| 3300024288|Ga0179589_10117494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1105 | Open in IMG/M |
| 3300025464|Ga0208076_1024197 | Not Available | 1053 | Open in IMG/M |
| 3300025898|Ga0207692_10148459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1340 | Open in IMG/M |
| 3300025905|Ga0207685_10071207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1410 | Open in IMG/M |
| 3300025906|Ga0207699_10093857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1889 | Open in IMG/M |
| 3300025912|Ga0207707_11238759 | Not Available | 602 | Open in IMG/M |
| 3300025920|Ga0207649_11120336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 621 | Open in IMG/M |
| 3300025929|Ga0207664_10452550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1146 | Open in IMG/M |
| 3300025941|Ga0207711_11357798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
| 3300025944|Ga0207661_10395924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1252 | Open in IMG/M |
| 3300025944|Ga0207661_12174354 | Not Available | 501 | Open in IMG/M |
| 3300025945|Ga0207679_10874216 | Not Available | 821 | Open in IMG/M |
| 3300025949|Ga0207667_10415394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1369 | Open in IMG/M |
| 3300026078|Ga0207702_10585556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1094 | Open in IMG/M |
| 3300026374|Ga0257146_1016236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1213 | Open in IMG/M |
| 3300026547|Ga0209156_10133357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
| 3300027725|Ga0209178_1106731 | Not Available | 940 | Open in IMG/M |
| 3300027765|Ga0209073_10081965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1113 | Open in IMG/M |
| 3300027787|Ga0209074_10012982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2110 | Open in IMG/M |
| 3300027787|Ga0209074_10416533 | Not Available | 566 | Open in IMG/M |
| 3300027817|Ga0209112_10029946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1608 | Open in IMG/M |
| 3300028791|Ga0307290_10030214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1920 | Open in IMG/M |
| 3300031128|Ga0170823_10135139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300031226|Ga0307497_10683791 | Not Available | 528 | Open in IMG/M |
| 3300031543|Ga0318516_10561383 | Not Available | 653 | Open in IMG/M |
| 3300031546|Ga0318538_10334780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
| 3300031572|Ga0318515_10166972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1175 | Open in IMG/M |
| 3300031640|Ga0318555_10816436 | Not Available | 504 | Open in IMG/M |
| 3300031846|Ga0318512_10529781 | Not Available | 598 | Open in IMG/M |
| 3300031938|Ga0308175_100082126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2910 | Open in IMG/M |
| 3300031938|Ga0308175_101872374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300031938|Ga0308175_101878876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 671 | Open in IMG/M |
| 3300032770|Ga0335085_10034404 | All Organisms → cellular organisms → Bacteria | 7013 | Open in IMG/M |
| 3300032782|Ga0335082_10968878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300032805|Ga0335078_12651288 | Not Available | 512 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.84% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.86% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.94% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.94% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.96% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.98% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_01379000 | 2170459002 | Grass Soil | MSKPPRRLRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSEP |
| JGI25404J52841_100139491 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGPEP* |
| Ga0062593_1005674452 | 3300004114 | Soil | LRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGAEP* |
| Ga0070683_1002046763 | 3300005329 | Corn Rhizosphere | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRPCDDDGVNPDRDI* |
| Ga0070709_105288631 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDI* |
| Ga0070714_1011337132 | 3300005435 | Agricultural Soil | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGANPGRDI* |
| Ga0070714_1018787161 | 3300005435 | Agricultural Soil | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRACDDDGVNPDRDV* |
| Ga0070713_1020658942 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKPPRRLRRSCPHDGGELLLDALGAFICEICGRTCDDDGVNPGRDI* |
| Ga0070711_1005330302 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKPPRRLRRSCPHDGGEFLRDALGAFICEVCGRACDDEGADPGRDS* |
| Ga0070711_1006993492 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRACDDDGVNPDRDI* |
| Ga0070700_1002481513 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAG |
| Ga0070684_1002135383 | 3300005535 | Corn Rhizosphere | MSKPPRRLRRSCPHDGGELLPDALGEFICEICGRPCDDDGVNPGRDI* |
| Ga0070730_105505022 | 3300005537 | Surface Soil | MSKPPRRLRRNCPHDGGELLRDALGEFICEICGRACDDDGSVPGRDI* |
| Ga0070672_1010659202 | 3300005543 | Miscanthus Rhizosphere | SCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP* |
| Ga0070715_105835562 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDI* |
| Ga0070712_1001445804 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKPPRRLRRSCPHDGGEFLRDALGAFICEVCGRACDDEGADPGRDSSQYRAK |
| Ga0079222_109257781 | 3300006755 | Agricultural Soil | MSKPPRRLRRSCPHDGGELLPDALGEFICEICGRACDDDGVNPGRDI* |
| Ga0066653_103756281 | 3300006791 | Soil | LRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGGEP* |
| Ga0079221_101086913 | 3300006804 | Agricultural Soil | RLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP* |
| Ga0079220_102332432 | 3300006806 | Agricultural Soil | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVDPGRDI* |
| Ga0075436_1001327653 | 3300006914 | Populus Rhizosphere | MSKPPRRLRRRCPHDGGELLPDAFGEFICEICGRTCDDDGANPGRDI* |
| Ga0105251_101036403 | 3300009011 | Switchgrass Rhizosphere | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP* |
| Ga0105242_105219041 | 3300009176 | Miscanthus Rhizosphere | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCDGEPPDAGTES* |
| Ga0126380_101542043 | 3300010043 | Tropical Forest Soil | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDVGPEP* |
| Ga0126318_102804972 | 3300010152 | Soil | MSKPPRRLRRSCPHDGGELLPDALGEFICEICGRACDDDGANPGRDI* |
| Ga0127503_110571162 | 3300010154 | Soil | MSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGGGP* |
| Ga0134064_102865262 | 3300010325 | Grasslands Soil | MSRPPRRLRRSCTHDGAGVLRDALGQFICDICGQPCEDESPDAEP* |
| Ga0134062_101568542 | 3300010337 | Grasslands Soil | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGAEP* |
| Ga0126376_115521192 | 3300010359 | Tropical Forest Soil | MSKPPRRLRRSCTHDGADLLRDALGQFVCEICGQAWDEDADPGVEP* |
| Ga0134128_106662112 | 3300010373 | Terrestrial Soil | ALTIPRDSVPRRRLRRSCPHDGGELLPDALGEFICEICGRPCDDDGVNQGRDI* |
| Ga0134128_119335722 | 3300010373 | Terrestrial Soil | MSKPPRRLRRSCPHDGGELLPDALGEYICEICGRTCDDDGANPGRDI* |
| Ga0105239_121741892 | 3300010375 | Corn Rhizosphere | MSRPPRRLRRSCTHDGADVLRDALGQFTCDICGQPCEDEPPD |
| Ga0134126_120293591 | 3300010396 | Terrestrial Soil | MSRPPRRLRRSCTHDGADLQRDALGQFICDICGQPCEDEPPDAGAEP |
| Ga0134126_130879461 | 3300010396 | Terrestrial Soil | HDGGELLPDALGAFICEICGRACDDDGVNPDRDI* |
| Ga0126351_10046991 | 3300010860 | Boreal Forest Soil | MSKPPRRLRRSCPHDGGDLLRDALGEFICEVCGRVCNEEGTDPGRDG* |
| Ga0126349_11550112 | 3300010861 | Boreal Forest Soil | MSKPPQRLRRSCPQDGGELLLDALGEFICEVCGRAWGDEGADPGRDG* |
| Ga0126349_12568871 | 3300010861 | Boreal Forest Soil | MRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSKP* |
| Ga0137365_100561363 | 3300012201 | Vadose Zone Soil | MSRPPRRLRRSCTHDGADLLRDALGQFICEICGQPCEDEPPDAGAEP* |
| Ga0137380_101979162 | 3300012206 | Vadose Zone Soil | MSRPPRRLRRSCTHDGADLLRDALGQFICEICGQPCEDDPPDAGAEP* |
| Ga0137381_104067813 | 3300012207 | Vadose Zone Soil | MSKPPRRLRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDAGSEP* |
| Ga0157349_10201121 | 3300012489 | Unplanted Soil | MSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGTEP* |
| Ga0157323_10221531 | 3300012495 | Arabidopsis Rhizosphere | RPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP* |
| Ga0157351_10056512 | 3300012501 | Unplanted Soil | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPGEDEPPDAGAEP* |
| Ga0137416_106794432 | 3300012927 | Vadose Zone Soil | MSRPPRRLRRSCAHDGANLLRDALGQFICDICGQPCEDEPPDAGTEP* |
| Ga0137404_106461252 | 3300012929 | Vadose Zone Soil | MSKPPRRLRRSCPHDGGQLLRNALGEFICEICGRACDDDGSVPGRDI* |
| Ga0137407_101468394 | 3300012930 | Vadose Zone Soil | MSKPPRRLRRSCPHDGGQLLRNALGEFICEICGRACDDD |
| Ga0164299_101782672 | 3300012958 | Soil | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPAAGAEP* |
| Ga0164299_104463862 | 3300012958 | Soil | MSKPPRRLRRSCPHDGGELLLDALGAFICEICGRACDDDGVNPDRAI* |
| Ga0164302_103195733 | 3300012961 | Soil | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEP |
| Ga0134087_106417811 | 3300012977 | Grasslands Soil | MSKPPRRLRRSCPHDGGEFLRDALGVFICEVCGRACEDEGADPGRDS* |
| Ga0157370_105241403 | 3300013104 | Corn Rhizosphere | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGT |
| Ga0157374_102907163 | 3300013296 | Miscanthus Rhizosphere | PRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP* |
| Ga0182000_102356792 | 3300014487 | Soil | MSKPPRRLRRRCPHDGGELLPDALGEFICEICGRACDDDGVNPGRDI* |
| Ga0157379_119799112 | 3300014968 | Switchgrass Rhizosphere | MNKPPRRLRRSCPHDGGELLPDALGAFICEICGRPCDDDGVNPDRDI* |
| Ga0137409_104288861 | 3300015245 | Vadose Zone Soil | MSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGTE |
| Ga0182035_119275301 | 3300016341 | Soil | MSKAPRRLRHSCPHDGGPLLRDALGQFICEVCGQPLDEE |
| Ga0182038_121338281 | 3300016445 | Soil | MSQPPRRLRHSCPHDGGQLLRDALGQFICEVCGRPLDEEGPEPGADC |
| Ga0066669_112005571 | 3300018482 | Grasslands Soil | MSRPLRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP |
| Ga0173482_100309932 | 3300019361 | Soil | LRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDASTEP |
| Ga0193692_10748992 | 3300020000 | Soil | MSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGGEP |
| Ga0193724_10899982 | 3300020062 | Soil | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGAEP |
| Ga0206356_114308452 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP |
| Ga0210399_106864621 | 3300020581 | Soil | KPPRRMRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSKP |
| Ga0213881_102051662 | 3300021374 | Exposed Rock | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDV |
| Ga0126371_102330631 | 3300021560 | Tropical Forest Soil | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGQACDDDGVNPGRDI |
| Ga0242665_103643181 | 3300022724 | Soil | MRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSEP |
| Ga0247670_10186013 | 3300024283 | Soil | PPGAMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP |
| Ga0179589_101174941 | 3300024288 | Vadose Zone Soil | RRSCTHDGAALLRDALGQFICDICGQPCEDEPPDAGTEP |
| Ga0208076_10241972 | 3300025464 | Arctic Peat Soil | MSKPPRRLRRSCPKDGGELLLDALGEFICEVCGQAWDDEGADPGRDDH |
| Ga0207692_101484592 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDI |
| Ga0207685_100712071 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDI |
| Ga0207699_100938573 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKPPRRLRRSCPHDGGELLLDALGAFICEICGRTCDDDGVNPGRDI |
| Ga0207707_112387591 | 3300025912 | Corn Rhizosphere | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRACDDDGVNPDRDV |
| Ga0207649_111203361 | 3300025920 | Corn Rhizosphere | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRPCDDDGVNPDRDI |
| Ga0207664_104525502 | 3300025929 | Agricultural Soil | MSKPPRRLRRNCPHDGGELLRDALGEFICEICGRACDDDGSVPGQDI |
| Ga0207711_113577981 | 3300025941 | Switchgrass Rhizosphere | RPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP |
| Ga0207661_103959243 | 3300025944 | Corn Rhizosphere | PHDGGELLPDALGAFICEICGRPCDDDGVNPGRDI |
| Ga0207661_121743542 | 3300025944 | Corn Rhizosphere | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTC |
| Ga0207679_108742161 | 3300025945 | Corn Rhizosphere | MSKPPRRLRRSCPHDGGELLPDALGEFICEICGRPCDDDGVNPDRDI |
| Ga0207667_104153943 | 3300025949 | Corn Rhizosphere | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPD |
| Ga0207702_105855562 | 3300026078 | Corn Rhizosphere | PRRLRRSCPHDGGELLPDALGEFICEICGRTCDDDGANPGRDI |
| Ga0257146_10162362 | 3300026374 | Soil | MSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDGGGEP |
| Ga0209156_101333573 | 3300026547 | Soil | PRRLRRSCAHDGAALLRDALGQFICDICGQPCEDDPPDAGPEP |
| Ga0209178_11067311 | 3300027725 | Agricultural Soil | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRACDDDGVNPDRDI |
| Ga0209073_100819652 | 3300027765 | Agricultural Soil | MSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVDPGRDI |
| Ga0209074_100129823 | 3300027787 | Agricultural Soil | MSKPPRRLRRSCPHDGGELLPDALGEFICEICGRACDDDGVNPGRDI |
| Ga0209074_104165331 | 3300027787 | Agricultural Soil | MSRPPRRLRRSCTHDGADLLRDALGQYICEICGQPCEDEPPDAGAEP |
| Ga0209112_100299462 | 3300027817 | Forest Soil | MSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDGTEP |
| Ga0307290_100302141 | 3300028791 | Soil | GAMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP |
| Ga0170823_101351392 | 3300031128 | Forest Soil | LRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSEP |
| Ga0307497_106837912 | 3300031226 | Soil | MSKPPRRLRRSCPHDGADLLRDALGQFICEICGQPCEDEPPDAGAEP |
| Ga0318516_105613832 | 3300031543 | Soil | MSKAPRRLRHSCPHDGGPLLRDALGQFICEVCGQPL |
| Ga0318538_103347802 | 3300031546 | Soil | AMSQPPRRLRHSCPHDGGQLLRDALGQFICEVCGRPLDEEGPEPGADC |
| Ga0318515_101669722 | 3300031572 | Soil | MSKAPRRLRHSCPHDGGPLLRDALGQFICEVCGQPLDEESPEPGGDC |
| Ga0318555_108164361 | 3300031640 | Soil | MSKAPRRLRHSCPHDGGQLLRDALGQFICEVCGRPLDEEGPEPGADC |
| Ga0318512_105297811 | 3300031846 | Soil | MSKAPRRLRHSCPHDGGPLLRDALGQFICEVCGRPLDEEGPEPGADC |
| Ga0308175_1000821264 | 3300031938 | Soil | MSKPPRRLRRSCPHDGGELLPDALGQFICEICGRACDDDGANPGRDI |
| Ga0308175_1018723742 | 3300031938 | Soil | MSKPPRRLRRSCPHDGGELLPDALGEFICEICGRTCDDDGANPGRDI |
| Ga0308175_1018788761 | 3300031938 | Soil | LRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGAEP |
| Ga0335085_100344043 | 3300032770 | Soil | MSKPPRRLRRSCPYDGGELLPDALGAFICEICGRACDDDGVNPGRDI |
| Ga0335082_109688782 | 3300032782 | Soil | MSKPPRRLRRRCPHDGGELLPDALGAFICEICGRTCDDDGANPGRDI |
| Ga0335078_126512881 | 3300032805 | Soil | LRRSCPRDGGELLRDALGEFICEICGRACDEEGADPDA |
| ⦗Top⦘ |