NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101946

Metagenome / Metatranscriptome Family F101946

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101946
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 45 residues
Representative Sequence MSKPPRRLRRSCPHDGADLLRDALGQFICEICGQPCEDEPPDAGAEP
Number of Associated Samples 92
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.84 %
% of genes near scaffold ends (potentially truncated) 31.37 %
% of genes from short scaffolds (< 2000 bps) 95.10 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.627 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(9.804 % of family members)
Environment Ontology (ENVO) Unclassified
(29.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.137 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 22.67%    β-sheet: 0.00%    Coil/Unstructured: 77.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF03640Lipoprotein_15 1.96
PF02803Thiolase_C 0.98
PF07690MFS_1 0.98
PF13520AA_permease_2 0.98
PF07920DUF1684 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 1.96
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.98
COG3358Uncharacterized conserved protein, DUF1684 familyFunction unknown [S] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.63 %
UnclassifiedrootN/A31.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459002|F0B48LX02IJ87ZNot Available514Open in IMG/M
3300003659|JGI25404J52841_10013949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1743Open in IMG/M
3300004114|Ga0062593_100567445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1072Open in IMG/M
3300005329|Ga0070683_100204676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1875Open in IMG/M
3300005434|Ga0070709_10528863Not Available899Open in IMG/M
3300005435|Ga0070714_101133713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia762Open in IMG/M
3300005435|Ga0070714_101878716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae584Open in IMG/M
3300005436|Ga0070713_102065894Not Available552Open in IMG/M
3300005439|Ga0070711_100533030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia972Open in IMG/M
3300005439|Ga0070711_100699349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae853Open in IMG/M
3300005441|Ga0070700_100248151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1275Open in IMG/M
3300005535|Ga0070684_100213538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1759Open in IMG/M
3300005537|Ga0070730_10550502Not Available739Open in IMG/M
3300005543|Ga0070672_101065920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia718Open in IMG/M
3300006163|Ga0070715_10583556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300006175|Ga0070712_100144580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1819Open in IMG/M
3300006755|Ga0079222_10925778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia736Open in IMG/M
3300006791|Ga0066653_10375628Not Available725Open in IMG/M
3300006804|Ga0079221_10108691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1378Open in IMG/M
3300006806|Ga0079220_10233243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1088Open in IMG/M
3300006914|Ga0075436_100132765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1747Open in IMG/M
3300009011|Ga0105251_10103640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1300Open in IMG/M
3300009176|Ga0105242_10521904Not Available1133Open in IMG/M
3300010043|Ga0126380_10154204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1476Open in IMG/M
3300010152|Ga0126318_10280497Not Available570Open in IMG/M
3300010154|Ga0127503_11057116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae640Open in IMG/M
3300010325|Ga0134064_10286526Not Available622Open in IMG/M
3300010337|Ga0134062_10156854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1016Open in IMG/M
3300010359|Ga0126376_11552119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300010373|Ga0134128_10666211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1156Open in IMG/M
3300010373|Ga0134128_11933572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae649Open in IMG/M
3300010375|Ga0105239_12174189Not Available645Open in IMG/M
3300010396|Ga0134126_12029359Not Available629Open in IMG/M
3300010396|Ga0134126_13087946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae502Open in IMG/M
3300010860|Ga0126351_1004699Not Available517Open in IMG/M
3300010861|Ga0126349_1155011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1000Open in IMG/M
3300010861|Ga0126349_1256887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia815Open in IMG/M
3300012201|Ga0137365_10056136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2975Open in IMG/M
3300012206|Ga0137380_10197916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1823Open in IMG/M
3300012207|Ga0137381_10406781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1187Open in IMG/M
3300012489|Ga0157349_1020112Not Available624Open in IMG/M
3300012495|Ga0157323_1022153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300012501|Ga0157351_1005651Not Available1010Open in IMG/M
3300012927|Ga0137416_10679443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia903Open in IMG/M
3300012929|Ga0137404_10646125Not Available954Open in IMG/M
3300012930|Ga0137407_10146839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2080Open in IMG/M
3300012958|Ga0164299_10178267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1206Open in IMG/M
3300012958|Ga0164299_10446386Not Available845Open in IMG/M
3300012961|Ga0164302_10319573Not Available1023Open in IMG/M
3300012977|Ga0134087_10641781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300013104|Ga0157370_10524140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1087Open in IMG/M
3300013296|Ga0157374_10290716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1615Open in IMG/M
3300014487|Ga0182000_10235679Not Available724Open in IMG/M
3300014968|Ga0157379_11979911Not Available575Open in IMG/M
3300015245|Ga0137409_10428886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1140Open in IMG/M
3300016341|Ga0182035_11927530Not Available536Open in IMG/M
3300016445|Ga0182038_12133828Not Available508Open in IMG/M
3300018482|Ga0066669_11200557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia685Open in IMG/M
3300019361|Ga0173482_10030993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1614Open in IMG/M
3300020000|Ga0193692_1074899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300020062|Ga0193724_1089998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia631Open in IMG/M
3300020070|Ga0206356_11430845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1271Open in IMG/M
3300020581|Ga0210399_10686462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia842Open in IMG/M
3300021374|Ga0213881_10205166Not Available871Open in IMG/M
3300021560|Ga0126371_10233063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1950Open in IMG/M
3300022724|Ga0242665_10364318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae520Open in IMG/M
3300024283|Ga0247670_1018601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1244Open in IMG/M
3300024288|Ga0179589_10117494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1105Open in IMG/M
3300025464|Ga0208076_1024197Not Available1053Open in IMG/M
3300025898|Ga0207692_10148459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1340Open in IMG/M
3300025905|Ga0207685_10071207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1410Open in IMG/M
3300025906|Ga0207699_10093857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1889Open in IMG/M
3300025912|Ga0207707_11238759Not Available602Open in IMG/M
3300025920|Ga0207649_11120336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae621Open in IMG/M
3300025929|Ga0207664_10452550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1146Open in IMG/M
3300025941|Ga0207711_11357798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia653Open in IMG/M
3300025944|Ga0207661_10395924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1252Open in IMG/M
3300025944|Ga0207661_12174354Not Available501Open in IMG/M
3300025945|Ga0207679_10874216Not Available821Open in IMG/M
3300025949|Ga0207667_10415394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1369Open in IMG/M
3300026078|Ga0207702_10585556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1094Open in IMG/M
3300026374|Ga0257146_1016236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1213Open in IMG/M
3300026547|Ga0209156_10133357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1211Open in IMG/M
3300027725|Ga0209178_1106731Not Available940Open in IMG/M
3300027765|Ga0209073_10081965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1113Open in IMG/M
3300027787|Ga0209074_10012982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2110Open in IMG/M
3300027787|Ga0209074_10416533Not Available566Open in IMG/M
3300027817|Ga0209112_10029946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1608Open in IMG/M
3300028791|Ga0307290_10030214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1920Open in IMG/M
3300031128|Ga0170823_10135139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300031226|Ga0307497_10683791Not Available528Open in IMG/M
3300031543|Ga0318516_10561383Not Available653Open in IMG/M
3300031546|Ga0318538_10334780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300031572|Ga0318515_10166972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1175Open in IMG/M
3300031640|Ga0318555_10816436Not Available504Open in IMG/M
3300031846|Ga0318512_10529781Not Available598Open in IMG/M
3300031938|Ga0308175_100082126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2910Open in IMG/M
3300031938|Ga0308175_101872374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia672Open in IMG/M
3300031938|Ga0308175_101878876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia671Open in IMG/M
3300032770|Ga0335085_10034404All Organisms → cellular organisms → Bacteria7013Open in IMG/M
3300032782|Ga0335082_10968878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300032805|Ga0335078_12651288Not Available512Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil6.86%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.94%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.96%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.98%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.98%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.98%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300012501Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024283Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025464Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E1_013790002170459002Grass SoilMSKPPRRLRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSEP
JGI25404J52841_1001394913300003659Tabebuia Heterophylla RhizosphereMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGPEP*
Ga0062593_10056744523300004114SoilLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGAEP*
Ga0070683_10020467633300005329Corn RhizosphereMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRPCDDDGVNPDRDI*
Ga0070709_1052886313300005434Corn, Switchgrass And Miscanthus RhizosphereMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDI*
Ga0070714_10113371323300005435Agricultural SoilMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGANPGRDI*
Ga0070714_10187871613300005435Agricultural SoilMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRACDDDGVNPDRDV*
Ga0070713_10206589423300005436Corn, Switchgrass And Miscanthus RhizosphereMSKPPRRLRRSCPHDGGELLLDALGAFICEICGRTCDDDGVNPGRDI*
Ga0070711_10053303023300005439Corn, Switchgrass And Miscanthus RhizosphereMSKPPRRLRRSCPHDGGEFLRDALGAFICEVCGRACDDEGADPGRDS*
Ga0070711_10069934923300005439Corn, Switchgrass And Miscanthus RhizosphereMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRACDDDGVNPDRDI*
Ga0070700_10024815133300005441Corn, Switchgrass And Miscanthus RhizosphereMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAG
Ga0070684_10021353833300005535Corn RhizosphereMSKPPRRLRRSCPHDGGELLPDALGEFICEICGRPCDDDGVNPGRDI*
Ga0070730_1055050223300005537Surface SoilMSKPPRRLRRNCPHDGGELLRDALGEFICEICGRACDDDGSVPGRDI*
Ga0070672_10106592023300005543Miscanthus RhizosphereSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP*
Ga0070715_1058355623300006163Corn, Switchgrass And Miscanthus RhizosphereLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDI*
Ga0070712_10014458043300006175Corn, Switchgrass And Miscanthus RhizosphereMSKPPRRLRRSCPHDGGEFLRDALGAFICEVCGRACDDEGADPGRDSSQYRAK
Ga0079222_1092577813300006755Agricultural SoilMSKPPRRLRRSCPHDGGELLPDALGEFICEICGRACDDDGVNPGRDI*
Ga0066653_1037562813300006791SoilLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGGEP*
Ga0079221_1010869133300006804Agricultural SoilRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP*
Ga0079220_1023324323300006806Agricultural SoilMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVDPGRDI*
Ga0075436_10013276533300006914Populus RhizosphereMSKPPRRLRRRCPHDGGELLPDAFGEFICEICGRTCDDDGANPGRDI*
Ga0105251_1010364033300009011Switchgrass RhizosphereMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP*
Ga0105242_1052190413300009176Miscanthus RhizosphereMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCDGEPPDAGTES*
Ga0126380_1015420433300010043Tropical Forest SoilMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDVGPEP*
Ga0126318_1028049723300010152SoilMSKPPRRLRRSCPHDGGELLPDALGEFICEICGRACDDDGANPGRDI*
Ga0127503_1105711623300010154SoilMSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGGGP*
Ga0134064_1028652623300010325Grasslands SoilMSRPPRRLRRSCTHDGAGVLRDALGQFICDICGQPCEDESPDAEP*
Ga0134062_1015685423300010337Grasslands SoilMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGAEP*
Ga0126376_1155211923300010359Tropical Forest SoilMSKPPRRLRRSCTHDGADLLRDALGQFVCEICGQAWDEDADPGVEP*
Ga0134128_1066621123300010373Terrestrial SoilALTIPRDSVPRRRLRRSCPHDGGELLPDALGEFICEICGRPCDDDGVNQGRDI*
Ga0134128_1193357223300010373Terrestrial SoilMSKPPRRLRRSCPHDGGELLPDALGEYICEICGRTCDDDGANPGRDI*
Ga0105239_1217418923300010375Corn RhizosphereMSRPPRRLRRSCTHDGADVLRDALGQFTCDICGQPCEDEPPD
Ga0134126_1202935913300010396Terrestrial SoilMSRPPRRLRRSCTHDGADLQRDALGQFICDICGQPCEDEPPDAGAEP
Ga0134126_1308794613300010396Terrestrial SoilHDGGELLPDALGAFICEICGRACDDDGVNPDRDI*
Ga0126351_100469913300010860Boreal Forest SoilMSKPPRRLRRSCPHDGGDLLRDALGEFICEVCGRVCNEEGTDPGRDG*
Ga0126349_115501123300010861Boreal Forest SoilMSKPPQRLRRSCPQDGGELLLDALGEFICEVCGRAWGDEGADPGRDG*
Ga0126349_125688713300010861Boreal Forest SoilMRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSKP*
Ga0137365_1005613633300012201Vadose Zone SoilMSRPPRRLRRSCTHDGADLLRDALGQFICEICGQPCEDEPPDAGAEP*
Ga0137380_1019791623300012206Vadose Zone SoilMSRPPRRLRRSCTHDGADLLRDALGQFICEICGQPCEDDPPDAGAEP*
Ga0137381_1040678133300012207Vadose Zone SoilMSKPPRRLRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDAGSEP*
Ga0157349_102011213300012489Unplanted SoilMSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGTEP*
Ga0157323_102215313300012495Arabidopsis RhizosphereRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP*
Ga0157351_100565123300012501Unplanted SoilMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPGEDEPPDAGAEP*
Ga0137416_1067944323300012927Vadose Zone SoilMSRPPRRLRRSCAHDGANLLRDALGQFICDICGQPCEDEPPDAGTEP*
Ga0137404_1064612523300012929Vadose Zone SoilMSKPPRRLRRSCPHDGGQLLRNALGEFICEICGRACDDDGSVPGRDI*
Ga0137407_1014683943300012930Vadose Zone SoilMSKPPRRLRRSCPHDGGQLLRNALGEFICEICGRACDDD
Ga0164299_1017826723300012958SoilMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPAAGAEP*
Ga0164299_1044638623300012958SoilMSKPPRRLRRSCPHDGGELLLDALGAFICEICGRACDDDGVNPDRAI*
Ga0164302_1031957333300012961SoilMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEP
Ga0134087_1064178113300012977Grasslands SoilMSKPPRRLRRSCPHDGGEFLRDALGVFICEVCGRACEDEGADPGRDS*
Ga0157370_1052414033300013104Corn RhizosphereMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGT
Ga0157374_1029071633300013296Miscanthus RhizospherePRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP*
Ga0182000_1023567923300014487SoilMSKPPRRLRRRCPHDGGELLPDALGEFICEICGRACDDDGVNPGRDI*
Ga0157379_1197991123300014968Switchgrass RhizosphereMNKPPRRLRRSCPHDGGELLPDALGAFICEICGRPCDDDGVNPDRDI*
Ga0137409_1042888613300015245Vadose Zone SoilMSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGTE
Ga0182035_1192753013300016341SoilMSKAPRRLRHSCPHDGGPLLRDALGQFICEVCGQPLDEE
Ga0182038_1213382813300016445SoilMSQPPRRLRHSCPHDGGQLLRDALGQFICEVCGRPLDEEGPEPGADC
Ga0066669_1120055713300018482Grasslands SoilMSRPLRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP
Ga0173482_1003099323300019361SoilLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDASTEP
Ga0193692_107489923300020000SoilMSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDAGGEP
Ga0193724_108999823300020062SoilMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGAEP
Ga0206356_1143084523300020070Corn, Switchgrass And Miscanthus RhizosphereMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP
Ga0210399_1068646213300020581SoilKPPRRMRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSKP
Ga0213881_1020516623300021374Exposed RockMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDV
Ga0126371_1023306313300021560Tropical Forest SoilMSKPPRRLRRSCPHDGGELLPDALGAFICEICGQACDDDGVNPGRDI
Ga0242665_1036431813300022724SoilMRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSEP
Ga0247670_101860133300024283SoilPPGAMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP
Ga0179589_1011749413300024288Vadose Zone SoilRRSCTHDGAALLRDALGQFICDICGQPCEDEPPDAGTEP
Ga0208076_102419723300025464Arctic Peat SoilMSKPPRRLRRSCPKDGGELLLDALGEFICEVCGQAWDDEGADPGRDDH
Ga0207692_1014845923300025898Corn, Switchgrass And Miscanthus RhizosphereMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDI
Ga0207685_1007120713300025905Corn, Switchgrass And Miscanthus RhizosphereLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVNPGRDI
Ga0207699_1009385733300025906Corn, Switchgrass And Miscanthus RhizosphereMSKPPRRLRRSCPHDGGELLLDALGAFICEICGRTCDDDGVNPGRDI
Ga0207707_1123875913300025912Corn RhizosphereMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRACDDDGVNPDRDV
Ga0207649_1112033613300025920Corn RhizosphereMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRPCDDDGVNPDRDI
Ga0207664_1045255023300025929Agricultural SoilMSKPPRRLRRNCPHDGGELLRDALGEFICEICGRACDDDGSVPGQDI
Ga0207711_1135779813300025941Switchgrass RhizosphereRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP
Ga0207661_1039592433300025944Corn RhizospherePHDGGELLPDALGAFICEICGRPCDDDGVNPGRDI
Ga0207661_1217435423300025944Corn RhizosphereMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTC
Ga0207679_1087421613300025945Corn RhizosphereMSKPPRRLRRSCPHDGGELLPDALGEFICEICGRPCDDDGVNPDRDI
Ga0207667_1041539433300025949Corn RhizosphereMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPD
Ga0207702_1058555623300026078Corn RhizospherePRRLRRSCPHDGGELLPDALGEFICEICGRTCDDDGANPGRDI
Ga0257146_101623623300026374SoilMSRPPRRLRRSCTHDGADVLRDALGQFICDICGQPCEDEPPDGGGEP
Ga0209156_1013335733300026547SoilPRRLRRSCAHDGAALLRDALGQFICDICGQPCEDDPPDAGPEP
Ga0209178_110673113300027725Agricultural SoilMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRACDDDGVNPDRDI
Ga0209073_1008196523300027765Agricultural SoilMSKPPRRLRRSCPHDGGELLPDALGAFICEICGRTCDDDGVDPGRDI
Ga0209074_1001298233300027787Agricultural SoilMSKPPRRLRRSCPHDGGELLPDALGEFICEICGRACDDDGVNPGRDI
Ga0209074_1041653313300027787Agricultural SoilMSRPPRRLRRSCTHDGADLLRDALGQYICEICGQPCEDEPPDAGAEP
Ga0209112_1002994623300027817Forest SoilMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDGTEP
Ga0307290_1003021413300028791SoilGAMSRPPRRLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGTEP
Ga0170823_1013513923300031128Forest SoilLRRSCAHDGADLLRDALGQFICEICGQPCEDDPPDGGSEP
Ga0307497_1068379123300031226SoilMSKPPRRLRRSCPHDGADLLRDALGQFICEICGQPCEDEPPDAGAEP
Ga0318516_1056138323300031543SoilMSKAPRRLRHSCPHDGGPLLRDALGQFICEVCGQPL
Ga0318538_1033478023300031546SoilAMSQPPRRLRHSCPHDGGQLLRDALGQFICEVCGRPLDEEGPEPGADC
Ga0318515_1016697223300031572SoilMSKAPRRLRHSCPHDGGPLLRDALGQFICEVCGQPLDEESPEPGGDC
Ga0318555_1081643613300031640SoilMSKAPRRLRHSCPHDGGQLLRDALGQFICEVCGRPLDEEGPEPGADC
Ga0318512_1052978113300031846SoilMSKAPRRLRHSCPHDGGPLLRDALGQFICEVCGRPLDEEGPEPGADC
Ga0308175_10008212643300031938SoilMSKPPRRLRRSCPHDGGELLPDALGQFICEICGRACDDDGANPGRDI
Ga0308175_10187237423300031938SoilMSKPPRRLRRSCPHDGGELLPDALGEFICEICGRTCDDDGANPGRDI
Ga0308175_10187887613300031938SoilLRRSCTHDGADLLRDALGQFICDICGQPCEDEPPDAGAEP
Ga0335085_1003440433300032770SoilMSKPPRRLRRSCPYDGGELLPDALGAFICEICGRACDDDGVNPGRDI
Ga0335082_1096887823300032782SoilMSKPPRRLRRRCPHDGGELLPDALGAFICEICGRTCDDDGANPGRDI
Ga0335078_1265128813300032805SoilLRRSCPRDGGELLRDALGEFICEICGRACDEEGADPDA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.