| Basic Information | |
|---|---|
| Family ID | F101884 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MNIDINTTITFDNLLSAKKRITQHIGGTRSGKTYAILQYLIVKALQ |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 25.49 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.20 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (40.196 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (42.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.84% β-sheet: 0.00% Coil/Unstructured: 62.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01165 | Ribosomal_S21 | 10.78 |
| PF01555 | N6_N4_Mtase | 7.84 |
| PF01467 | CTP_transf_like | 3.92 |
| PF13392 | HNH_3 | 2.94 |
| PF13673 | Acetyltransf_10 | 1.96 |
| PF01541 | GIY-YIG | 0.98 |
| PF02954 | HTH_8 | 0.98 |
| PF13455 | MUG113 | 0.98 |
| PF00856 | SET | 0.98 |
| PF07453 | NUMOD1 | 0.98 |
| PF04466 | Terminase_3 | 0.98 |
| PF04542 | Sigma70_r2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 10.78 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 7.84 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 7.84 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 7.84 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.98 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.98 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.98 |
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.98 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.80 % |
| Unclassified | root | N/A | 40.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10241566 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 574 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10119188 | Not Available | 956 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10232470 | Not Available | 571 | Open in IMG/M |
| 3300001346|JGI20151J14362_10050098 | All Organisms → Viruses → Predicted Viral | 1827 | Open in IMG/M |
| 3300002294|B570J29584_1012322 | Not Available | 534 | Open in IMG/M |
| 3300002835|B570J40625_100734516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300004124|Ga0066178_10252159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300005086|Ga0072334_11188062 | Not Available | 500 | Open in IMG/M |
| 3300005527|Ga0068876_10512704 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005581|Ga0049081_10070754 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300006164|Ga0075441_10131103 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 951 | Open in IMG/M |
| 3300006191|Ga0075447_10154270 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 770 | Open in IMG/M |
| 3300006790|Ga0098074_1128417 | Not Available | 658 | Open in IMG/M |
| 3300006790|Ga0098074_1173418 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006793|Ga0098055_1013972 | All Organisms → Viruses → Predicted Viral | 3536 | Open in IMG/M |
| 3300006916|Ga0070750_10286493 | Not Available | 707 | Open in IMG/M |
| 3300006922|Ga0098045_1013841 | All Organisms → Viruses → Predicted Viral | 2235 | Open in IMG/M |
| 3300007540|Ga0099847_1040879 | All Organisms → Viruses → Predicted Viral | 1475 | Open in IMG/M |
| 3300007963|Ga0110931_1183985 | Not Available | 625 | Open in IMG/M |
| 3300008050|Ga0098052_1252836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
| 3300008107|Ga0114340_1116142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
| 3300008107|Ga0114340_1139558 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300008259|Ga0114841_1172192 | Not Available | 825 | Open in IMG/M |
| 3300008266|Ga0114363_1134698 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300008450|Ga0114880_1245996 | Not Available | 562 | Open in IMG/M |
| 3300009081|Ga0105098_10782207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
| 3300009165|Ga0105102_10440712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300009165|Ga0105102_10924776 | Not Available | 504 | Open in IMG/M |
| 3300009183|Ga0114974_10788767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
| 3300009425|Ga0114997_10188418 | Not Available | 1194 | Open in IMG/M |
| 3300009428|Ga0114915_1023061 | All Organisms → Viruses → Predicted Viral | 2203 | Open in IMG/M |
| 3300009467|Ga0115565_10187987 | Not Available | 955 | Open in IMG/M |
| 3300009495|Ga0115571_1081875 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300010354|Ga0129333_10500605 | Not Available | 1065 | Open in IMG/M |
| 3300010885|Ga0133913_10867887 | All Organisms → Viruses → Predicted Viral | 2346 | Open in IMG/M |
| 3300012013|Ga0153805_1044617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300017707|Ga0181363_1090386 | Not Available | 519 | Open in IMG/M |
| 3300017723|Ga0181362_1001423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5018 | Open in IMG/M |
| 3300017723|Ga0181362_1091240 | Not Available | 610 | Open in IMG/M |
| 3300017727|Ga0181401_1023223 | Not Available | 1833 | Open in IMG/M |
| 3300017736|Ga0181365_1026261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1468 | Open in IMG/M |
| 3300017747|Ga0181352_1068556 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300017750|Ga0181405_1070099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300017755|Ga0181411_1054206 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
| 3300017763|Ga0181410_1122175 | Not Available | 744 | Open in IMG/M |
| 3300017765|Ga0181413_1031132 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
| 3300017766|Ga0181343_1212684 | Not Available | 528 | Open in IMG/M |
| 3300017776|Ga0181394_1077308 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
| 3300017778|Ga0181349_1277467 | Not Available | 550 | Open in IMG/M |
| 3300017780|Ga0181346_1221229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300017784|Ga0181348_1247738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300017818|Ga0181565_10716975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
| 3300017971|Ga0180438_11011231 | Not Available | 602 | Open in IMG/M |
| 3300018410|Ga0181561_10254950 | Not Available | 832 | Open in IMG/M |
| 3300018428|Ga0181568_10197376 | All Organisms → Viruses → Predicted Viral | 1668 | Open in IMG/M |
| 3300019784|Ga0181359_1092377 | All Organisms → Viruses → Predicted Viral | 1120 | Open in IMG/M |
| 3300020161|Ga0211726_10329211 | Not Available | 685 | Open in IMG/M |
| 3300020352|Ga0211505_1090159 | Not Available | 734 | Open in IMG/M |
| 3300020550|Ga0208600_1013941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1293 | Open in IMG/M |
| 3300021140|Ga0214168_1010929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2837 | Open in IMG/M |
| 3300021356|Ga0213858_10510656 | Not Available | 554 | Open in IMG/M |
| 3300021960|Ga0222715_10439529 | Not Available | 705 | Open in IMG/M |
| 3300021961|Ga0222714_10501469 | Not Available | 623 | Open in IMG/M |
| 3300021962|Ga0222713_10221712 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300022190|Ga0181354_1013176 | All Organisms → Viruses → Predicted Viral | 2494 | Open in IMG/M |
| 3300022190|Ga0181354_1103676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
| 3300024346|Ga0244775_10550745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300024346|Ga0244775_11069558 | Not Available | 634 | Open in IMG/M |
| 3300025083|Ga0208791_1076728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300025085|Ga0208792_1018746 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
| 3300025115|Ga0209835_1161995 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin133 | 538 | Open in IMG/M |
| 3300025128|Ga0208919_1236415 | Not Available | 535 | Open in IMG/M |
| 3300025276|Ga0208814_1022272 | All Organisms → Viruses → Predicted Viral | 2101 | Open in IMG/M |
| 3300025896|Ga0208916_10098112 | Not Available | 1237 | Open in IMG/M |
| 3300026097|Ga0209953_1015210 | All Organisms → Viruses → Predicted Viral | 1450 | Open in IMG/M |
| 3300027668|Ga0209482_1050602 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
| 3300027736|Ga0209190_1257652 | Not Available | 686 | Open in IMG/M |
| 3300027793|Ga0209972_10204402 | Not Available | 913 | Open in IMG/M |
| 3300027804|Ga0209358_10482879 | Not Available | 567 | Open in IMG/M |
| 3300027808|Ga0209354_10065919 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
| 3300028025|Ga0247723_1056084 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
| 3300029345|Ga0135210_1030728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
| 3300031519|Ga0307488_10337676 | Not Available | 955 | Open in IMG/M |
| 3300031601|Ga0307992_1194149 | Not Available | 758 | Open in IMG/M |
| 3300031673|Ga0307377_10716588 | Not Available | 701 | Open in IMG/M |
| 3300031707|Ga0315291_10155908 | All Organisms → Viruses → Predicted Viral | 2383 | Open in IMG/M |
| 3300031857|Ga0315909_10317499 | Not Available | 1155 | Open in IMG/M |
| 3300031857|Ga0315909_10439996 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031857|Ga0315909_10505265 | Not Available | 833 | Open in IMG/M |
| 3300031885|Ga0315285_10686012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300031885|Ga0315285_10749031 | Not Available | 621 | Open in IMG/M |
| 3300031885|Ga0315285_10956772 | Not Available | 518 | Open in IMG/M |
| 3300031999|Ga0315274_10408737 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium TMED42 | 1570 | Open in IMG/M |
| 3300031999|Ga0315274_10515989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1346 | Open in IMG/M |
| 3300032050|Ga0315906_11154442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300032053|Ga0315284_11698057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300032274|Ga0316203_1015686 | All Organisms → Viruses → Predicted Viral | 2262 | Open in IMG/M |
| 3300032342|Ga0315286_11670678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300033994|Ga0334996_0174535 | All Organisms → Viruses → Predicted Viral | 1172 | Open in IMG/M |
| 3300034102|Ga0335029_0545978 | Not Available | 662 | Open in IMG/M |
| 3300034104|Ga0335031_0132650 | All Organisms → Viruses → Predicted Viral | 1734 | Open in IMG/M |
| 3300034122|Ga0335060_0650381 | Not Available | 525 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.67% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.80% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.84% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.92% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.92% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.94% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.94% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.94% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.94% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.94% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.96% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.98% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.98% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.98% |
| Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.98% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.98% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.98% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.98% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.98% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.98% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.98% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.98% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.98% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.98% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025115 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029345 | Marine harbor viral communities from the Indian Ocean - SCH1 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031601 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102415661 | 3300000101 | Marine | MNIDINTTITFDNLLSANKRITQHIGGTRSGKTYAVLQYLIVKALQEPQNITIVRRT |
| DelMOSpr2010_101191884 | 3300000116 | Marine | MELTVNTTLTFDNLLSANKRITQHIGGTRSGKTYAILQYLIVK |
| DelMOSpr2010_102324701 | 3300000116 | Marine | MEVTINTTVTFDNLIGAQKRITQHIGGTRSGKTYAILQYLIVKALQEQQN |
| JGI20151J14362_100500981 | 3300001346 | Pelagic Marine | MNIDINTTITFDNLLSAKKRITQHIGGTRSGKTYAILQYLIVKALQ |
| B570J29584_10123222 | 3300002294 | Freshwater | VNIEINTTVTFENLLDSIARTTHHIGGTRSGKSFAILQYCIVQAIEHAQTITIVRKTIPS |
| B570J40625_1007345161 | 3300002835 | Freshwater | MNLEINTTVTFEHLLDAKNRVTHHLGGTRSGKTFGILQYL |
| Ga0066178_102521592 | 3300004124 | Freshwater Lake | MPEQINIQTTQTFQNLLDSDKRVSQHIGGTRSGKTYAILQYLL |
| Ga0072334_111880622 | 3300005086 | Water | VEVQINTTITFDNLLGAQKRITHHVGGTRSGKTYAILQYLIVKALQEEQNITIVRRTV |
| Ga0068876_105127043 | 3300005527 | Freshwater Lake | MEVTINTTVTFENLLESKSRISQHIGGTRSGKTYAILQYLIVESLKT |
| Ga0049081_100707545 | 3300005581 | Freshwater Lentic | VEVTINTTITFENLLDSTKRISQHIGGTRSGKTYAILQFLIV |
| Ga0075441_101311033 | 3300006164 | Marine | MELTIDTTVTFDNLLSSSKRITHHVGGTRSGKTYAILQY |
| Ga0075447_101542703 | 3300006191 | Marine | MELTIDTTVTFDNLLSSSHRITHHVGGTRSGKTYAILQYLIVKSLQEQQNITVVRRT |
| Ga0098074_11284173 | 3300006790 | Marine | MEIQINTTITFDNLLSAKKRITHHVGGTRSGKTYAILQYLIVK |
| Ga0098074_11734181 | 3300006790 | Marine | VELQINTTITFDNLLSARKRITQHIGGTRSGKTYAILQYLIVQALQSRNDI |
| Ga0098055_101397212 | 3300006793 | Marine | VEVQINTTITFDNLLGAQKRITHHVGGTRSGKTYAILQYLIVKALQ |
| Ga0070750_102864931 | 3300006916 | Aqueous | MEIQINTTITFDNLLSAKKRITHHVGGTRSGKTYAILQYLIVKALQE |
| Ga0098045_10138417 | 3300006922 | Marine | VKITIDTTITFDNLIGSQKRITQHIGGTRSGKTYAILQYLIVRALQERLDIT |
| Ga0099847_10408794 | 3300007540 | Aqueous | MKIDINTSITFDNLINSEKRVSQHIGGTRSGKTYAILQWLIVRAIQEKQDI |
| Ga0110931_11839853 | 3300007963 | Marine | VKNLTVNTTVTFDNLLGAKKRITHHIGGTRSGKTYAILQYLIVKALQEELNITIVRR |
| Ga0098052_12528363 | 3300008050 | Marine | MELTVNTTITFDNLLSAKKRITQHIGGTRSGKTYAILQYLIVKALQEPQNITIVRR |
| Ga0114340_11161424 | 3300008107 | Freshwater, Plankton | MEVSIDTAITFEHLIESTKRISHHIGGTRSGKTYSILQYLIVEGFKEAIDIT |
| Ga0114340_11395583 | 3300008107 | Freshwater, Plankton | MNVEINTTVTFENLLESKSRISQHIGGTRSGKTYAILQYLIV |
| Ga0114841_11721921 | 3300008259 | Freshwater, Plankton | VEVTINTTVTFENLLESKSRISQHIGGTRSGKTYAILQYLIVESLKTP |
| Ga0114363_11346983 | 3300008266 | Freshwater, Plankton | MKLKIDTTITYSNILDSTKRVSQHIGGTRSGKTYAILQYLLVE |
| Ga0114880_12459962 | 3300008450 | Freshwater Lake | MEITIDTSITFENLLESTKRITHHIGGTRSGKTYAILQYLIVEGLKQQSDITIVR |
| Ga0105098_107822071 | 3300009081 | Freshwater Sediment | MNLEINTTVTFEHLLDSKHRVTQHIGGTRSGKTFGILQFLIVEAIKSAQTITIV |
| Ga0105102_104407123 | 3300009165 | Freshwater Sediment | VNLEINTTVTYEHLLDAQSRITQHIGGTRSGKTYAILQWIIVQALQS |
| Ga0105102_109247761 | 3300009165 | Freshwater Sediment | VNLEINTTISFEHLLDSKNRVTQHIGGTRSGKTYAILQWIIVQALQS |
| Ga0114974_107887671 | 3300009183 | Freshwater Lake | VEITIDTTVTFEHLLESQSRVIQCIGGTRSGKTYAILQFLIVKGLESKQTITVVRRT |
| Ga0114997_101884181 | 3300009425 | Marine | MELTVNTTVTFDNLLSAKKRITQHVGGTRSGKTYAV |
| Ga0114915_10230615 | 3300009428 | Deep Ocean | MELTIDTTVTFDNLLSSSHRITHHVGGTRSGKTYAILQYLIVKSLQEQQNITVVRRTV |
| Ga0115565_101879871 | 3300009467 | Pelagic Marine | VEVTINTTITFDNLIGAQKRITQHIGGTRSGKTYAILQYLI |
| Ga0115571_10818753 | 3300009495 | Pelagic Marine | MELTVNTTTTFDNLLSANKRITQHIGGTRSGKTYAILQYLIV |
| Ga0129333_105006054 | 3300010354 | Freshwater To Marine Saline Gradient | MEVTIDTAITFEHLLESTKRISHHCGGTRSGKTVSILQYLIVE |
| Ga0133913_108678871 | 3300010885 | Freshwater Lake | VNLEINTTITFENLLDSKTRVTQHIGGTRSGKTYA |
| Ga0153805_10446171 | 3300012013 | Surface Ice | VEVTINTTVTYENLLNSTNRVSQHIGGTRSGKTYAILQFLIVEAL |
| Ga0181363_10903862 | 3300017707 | Freshwater Lake | LEITIDTTVTFDNILNSIARTTHHIGGTRSGKSFAILQYCIVQAI |
| Ga0181362_10014231 | 3300017723 | Freshwater Lake | VEVQINTTITFENLLESKSRVTQHIGGTRSGKTYAILQFLIVQALERPQTITI |
| Ga0181362_10912403 | 3300017723 | Freshwater Lake | VEVTINTTVTFEHLLESQSRVIQCIGGTRSGKTYAILQFLIVKGLESKQTITV |
| Ga0181401_10232236 | 3300017727 | Seawater | MEITINTTVTFDNLMGAQKRITQHIGGTRSGKTYAILQYLIVKALQE |
| Ga0181365_10262615 | 3300017736 | Freshwater Lake | MPEQINIQTTQTFQNLLDSDKRVSQHIGGTRSGKTYAILQYLLVKMI |
| Ga0181352_10685564 | 3300017747 | Freshwater Lake | VEVNINTTVTFEHLLESNSRVTQHIGGTRSGKSYGILQFLIVKGLE |
| Ga0181405_10700991 | 3300017750 | Seawater | MELTVNTTLTFDNLLSAKKRITQHIGGTRSGKTYAILQYLIVN |
| Ga0181411_10542061 | 3300017755 | Seawater | MELTVNTTLTFDNLLSAKKRITQHIGGTRSGKTYAILQYLIVKALQEAQNITIVRRTV |
| Ga0181410_11221753 | 3300017763 | Seawater | MELTVNTTLTFDNLLSAKKRITQHIGGTRSGKTYAILQYLIVKALQEA |
| Ga0181413_10311326 | 3300017765 | Seawater | VNITIDTTITFDNLIEASKRVTQHIGGTRSGKTYAILQWLIVRALQETLDITVVR |
| Ga0181343_12126841 | 3300017766 | Freshwater Lake | VEVVINTTVTFENLLESNARVSQHIGGTRSGKTYAI |
| Ga0181394_10773081 | 3300017776 | Seawater | MELTVNTTLTFDNLLSANKRITQHIGGTRSGKTYSL |
| Ga0181349_12774671 | 3300017778 | Freshwater Lake | VEVQIDTTISFQHLLDAKSRVTQHIGGTRSGKSYGILQWIIVEALQNSF |
| Ga0181346_12212291 | 3300017780 | Freshwater Lake | MNLTIDTTITFDNLLDSTYRVSQHIGGTRSGKTYAILQYLI |
| Ga0181348_12477382 | 3300017784 | Freshwater Lake | VEVQINTTITFENLLESKSRVTQHIGGTRSGKTYAILQFLIVQALERPQ |
| Ga0181565_107169751 | 3300017818 | Salt Marsh | MNITIDTSVTFDNLLSARERVTQHIGGTRSGKTYAILQWLIVRGLQEKLDITVVRKT |
| Ga0180438_110112313 | 3300017971 | Hypersaline Lake Sediment | VEITVDTTVTFENILESTQRIQHHIGGTRSGKTYALLQYCIVQALQQPQ |
| Ga0181561_102549501 | 3300018410 | Salt Marsh | MKIDINTSITFDNLIQSDKRITQHIGGTRSGKTYAILQWL |
| Ga0181568_101973761 | 3300018428 | Salt Marsh | MNVDINTTITFENLLGAQKRITHHVGGTRSGKTYAILQY |
| Ga0181359_10923771 | 3300019784 | Freshwater Lake | VEVTINTTITFENLLESNARVSHHIGGTRSGKTYAIL |
| Ga0211726_103292113 | 3300020161 | Freshwater | VNLEINTTVTFENLLDSQSRVTQHIGGTRSGKTYAVLQFLIVKA |
| Ga0211505_10901591 | 3300020352 | Marine | VEVTINTTITFDNLIGAQKRITQHIGGTRSGKTYAILQYLIVKALQEPQNITIVRRT |
| Ga0208600_10139411 | 3300020550 | Freshwater | VNIEINTTVTFENLLDSIARTTHHIGGTRSGKSFAILQYCIVQAIEHAQTITIVRK |
| Ga0214168_10109299 | 3300021140 | Freshwater | VNIEINTTITFQHLVDSKHRVTHHIGGTRSGKTFGILQYLIVEAIREAQTITIVRRTIPS |
| Ga0213858_105106563 | 3300021356 | Seawater | VEVQINTTITFDNLLGAKKRITHHVGGTRSGKTYAILQYLIVKALQEPQNI |
| Ga0222715_104395291 | 3300021960 | Estuarine Water | MNIEINTTITFDNLISARKRVTQHIGGTRSGKTYAILQYLIVQGLQSPTD |
| Ga0222714_105014693 | 3300021961 | Estuarine Water | MNVEINTTITFENVMASSERVTQHIGGTRSGKTYAILQYL |
| Ga0222713_102217125 | 3300021962 | Estuarine Water | VEVKINTTLTFENLLESHSRVTQHIGGTRSGKTYAILQYLIVKSIENPQS |
| Ga0181354_10131768 | 3300022190 | Freshwater Lake | VEVQINTTITFENLLESKSRVTQHIGGTRSGKTYAILQFLIVQALERP |
| Ga0181354_11036761 | 3300022190 | Freshwater Lake | MPSQIDIQTTITYGHIENAKSRITQHIGGTRSGKTYAILQWLLVQ |
| Ga0244775_105507451 | 3300024346 | Estuarine | MNLEINTTVTFEHLLDAKSRVTQHIGGTRSGKSYGILQWI |
| Ga0244775_110695583 | 3300024346 | Estuarine | VEVTINTTITFENLLESNSRVTQHIGGTRSGKTYAILQFLIVEGLK |
| Ga0208791_10767281 | 3300025083 | Marine | VKITIDTTITFDNLIGSQKRITQHIGGTRSGKTYAILQYLIVRALQER |
| Ga0208792_10187463 | 3300025085 | Marine | MELTVNTTTTFDNLLSANKRITQHIGGTRSGKTYAILQYLIVKALQEPQNITIVRRTVP |
| Ga0209835_11619951 | 3300025115 | Anoxic Lake Water | MNLEINTTVTYGHVQNAKSRITQHIGGTRSGKTYAILQWLLVQM |
| Ga0208919_12364151 | 3300025128 | Marine | MEVTINTTVTFDNLVSANKRITQHIGGTRSGKTYAILQY |
| Ga0208814_10222721 | 3300025276 | Deep Ocean | MELTIDTTVTFDNLLSSSHRITHHVGGTRSGKTYAILQ |
| Ga0208916_100981125 | 3300025896 | Aqueous | VNIEINTTITYEHLLDANHRITQHIGGTRSGKTYAILQYLIT |
| Ga0209953_10152101 | 3300026097 | Pond Water | VEITVDTTVTFENILESTQRIQHHIGGTRSGKTYALLQYCIVQALQ |
| Ga0209482_10506021 | 3300027668 | Marine | MELTIDTTVTFDNLLSSSHRITHHVGGTRSGKTYAILQYLIV |
| Ga0209190_12576523 | 3300027736 | Freshwater Lake | VNLEINTTITFENLLDSKTRVTQHIGGTRSGKTYAILQF |
| Ga0209972_102044021 | 3300027793 | Freshwater Lake | MEVTINTTVTFENLLESKSRISQHIGGTRSGKTYAILQYLIVESLKTPLTITI |
| Ga0209358_104828792 | 3300027804 | Freshwater Lake | VEVTINTTITFENLLESNARVSHHIGGTRSGKTYAILQFLIVR |
| Ga0209354_100659194 | 3300027808 | Freshwater Lake | MEVTLNTTITFENLMNSTSRVTQHIGGTRSGKTYAILQY |
| Ga0247723_10560841 | 3300028025 | Deep Subsurface Sediment | VNLEINTTVTFEHLLDAKSRITQHIGGTRSGKSWAILQWII |
| Ga0135210_10307281 | 3300029345 | Marine Harbor | VKNLTVNTTVTFDNLLGAKKRITHHIGGTRSGKTYAILQYLIVKALQ |
| Ga0307488_103376764 | 3300031519 | Sackhole Brine | MELTIDTTITFDNLLGAQNRITHHVGGTRSGKTYAILQYLIVKALQEPQNITIVRR |
| Ga0307992_11941491 | 3300031601 | Marine | MDITINTTITFDNLLESSKRVTHHVGGTRSGKTYAILQYLTVKALQEPQNITVV |
| Ga0307377_107165883 | 3300031673 | Soil | VKNLTIDTTISFDNLLNANKRVTQHIGGTRSGKTYAILQWLIVRAI |
| Ga0315291_101559086 | 3300031707 | Sediment | MPEQINIQTTQTFQNLLDSNKRVSQHIGGTRSGKTYAILQYLLV |
| Ga0315909_103174994 | 3300031857 | Freshwater | MEVTINTTVTFENLLESKSRISQHIGGTRSGKTYAILQYLIVESLKTPLTIT |
| Ga0315909_104399961 | 3300031857 | Freshwater | MNVEINTTVTFENLLESKSRISQHIGGTRSGKTYAILQYLIVESLK |
| Ga0315909_105052651 | 3300031857 | Freshwater | VEVTINTTVTFENLLESKSRISQHIGGTRSGKTYAILQYLIVESLK |
| Ga0315285_106860121 | 3300031885 | Sediment | VNIEINTTITFEHLLESNSRVTQHIGGTRSGKSYGVLQFLIVEGLKATQ |
| Ga0315285_107490311 | 3300031885 | Sediment | MLNEHLTSMKISLETTVTYQNLLDSHKRISQHIGGTRSGKSYAILQ |
| Ga0315285_109567721 | 3300031885 | Sediment | VEVTINTTVTFEHLLESQSRVIQCIGGTRSGKTYAILQFLIVKGLESKQTITVV |
| Ga0315274_104087371 | 3300031999 | Sediment | MNLEINTTITFENLIDAKQRVSHHIGGTRSGKTYAILQYLIVKAIETTQNITI |
| Ga0315274_105159891 | 3300031999 | Sediment | VNIEINTTITFEHLLESNSRVTQHIGGTRSGKSYG |
| Ga0315906_111544422 | 3300032050 | Freshwater | VNLEINTTITFENLLDAKNRITHHIGGTRSGKTYAIIQFLIVEALQTAQTITIVRK |
| Ga0315284_116980571 | 3300032053 | Sediment | VNLEINTTITFENLLDSKHRVTHHIGGTRSGKTYAIIQFLI |
| Ga0316203_10156868 | 3300032274 | Microbial Mat | VEVKKLTIDTSVTFDNLLGSKKRVTQHIGGTRSGKTYAILQH |
| Ga0315286_116706781 | 3300032342 | Sediment | MPEQINIQTTQTFQNLLDSNKRVSQHIGGTRSGKTYAILKYLLV |
| Ga0334996_0174535_3_140 | 3300033994 | Freshwater | MNLEINTTVTFEHLLDAQSRITQHIGGTRSGKTYAILQWIIVQALQ |
| Ga0335029_0545978_1_147 | 3300034102 | Freshwater | MNLEINTTITFENLLDSKSRVTQHIGGTRSGKTYAILQYLIVKGIENKE |
| Ga0335031_0132650_1630_1734 | 3300034104 | Freshwater | MEVQINTTITFENLLESKARVSQHIGGTRSGKSYG |
| Ga0335060_0650381_418_525 | 3300034122 | Freshwater | MEVNINTTITFEHLLDAKNRITHHIGGTRSGKTYAI |
| ⦗Top⦘ |