 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F101860 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGTV |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 42.16 % |
| % of genes near scaffold ends (potentially truncated) | 21.57 % |
| % of genes from short scaffolds (< 2000 bps) | 75.49 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified viruses (69.608 % of family members) |
| NCBI Taxonomy ID | 12429 |
| Taxonomy | All Organisms → Viruses → unclassified viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (42.157 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.451 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.216 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 66.67% β-sheet: 0.00% Coil/Unstructured: 33.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.59 % |
| Unclassified | root | N/A | 29.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10014077 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4962 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10026402 | Not Available | 3271 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10037331 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2583 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10043525 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2316 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10123864 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1009 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10135435 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 935 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10147707 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 868 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10021589 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3038 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10032109 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2304 | Open in IMG/M |
| 3300001450|JGI24006J15134_10072722 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1313 | Open in IMG/M |
| 3300005078|Ga0070770_10217030 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 981 | Open in IMG/M |
| 3300005078|Ga0070770_10226702 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 740 | Open in IMG/M |
| 3300005086|Ga0072334_10443291 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1612 | Open in IMG/M |
| 3300005882|Ga0080455_1029327 | Not Available | 2428 | Open in IMG/M |
| 3300005882|Ga0080455_1029726 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2399 | Open in IMG/M |
| 3300005882|Ga0080455_1102836 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 738 | Open in IMG/M |
| 3300005882|Ga0080455_1113352 | Not Available | 673 | Open in IMG/M |
| 3300006165|Ga0075443_10247790 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 646 | Open in IMG/M |
| 3300006637|Ga0075461_10214325 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 573 | Open in IMG/M |
| 3300007896|Ga0111484_1007552 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2441 | Open in IMG/M |
| 3300007896|Ga0111484_1046003 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 897 | Open in IMG/M |
| 3300007907|Ga0111546_101475 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2372 | Open in IMG/M |
| 3300007907|Ga0111546_102921 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1668 | Open in IMG/M |
| 3300009071|Ga0115566_10339592 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 877 | Open in IMG/M |
| 3300009149|Ga0114918_10143692 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1431 | Open in IMG/M |
| 3300009149|Ga0114918_10294935 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 908 | Open in IMG/M |
| 3300009420|Ga0114994_10219635 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1277 | Open in IMG/M |
| 3300009420|Ga0114994_10490631 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 810 | Open in IMG/M |
| 3300009420|Ga0114994_10838074 | Not Available | 597 | Open in IMG/M |
| 3300009425|Ga0114997_10141051 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1432 | Open in IMG/M |
| 3300009425|Ga0114997_10209960 | Not Available | 1115 | Open in IMG/M |
| 3300009425|Ga0114997_10225467 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1066 | Open in IMG/M |
| 3300009433|Ga0115545_1168828 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 757 | Open in IMG/M |
| 3300009505|Ga0115564_10477060 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 603 | Open in IMG/M |
| 3300009705|Ga0115000_11032166 | Not Available | 501 | Open in IMG/M |
| 3300010296|Ga0129348_1308195 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 528 | Open in IMG/M |
| 3300011258|Ga0151677_1012028 | Not Available | 2367 | Open in IMG/M |
| 3300012953|Ga0163179_10295250 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1280 | Open in IMG/M |
| 3300017697|Ga0180120_10330326 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 606 | Open in IMG/M |
| 3300017709|Ga0181387_1031924 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1033 | Open in IMG/M |
| 3300017710|Ga0181403_1034551 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1064 | Open in IMG/M |
| 3300017713|Ga0181391_1118086 | Not Available | 595 | Open in IMG/M |
| 3300017714|Ga0181412_1085674 | Not Available | 753 | Open in IMG/M |
| 3300017720|Ga0181383_1042581 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1220 | Open in IMG/M |
| 3300017720|Ga0181383_1068534 | Not Available | 953 | Open in IMG/M |
| 3300017726|Ga0181381_1045249 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 971 | Open in IMG/M |
| 3300017728|Ga0181419_1012494 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2467 | Open in IMG/M |
| 3300017728|Ga0181419_1079198 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 823 | Open in IMG/M |
| 3300017729|Ga0181396_1005715 | Not Available | 2520 | Open in IMG/M |
| 3300017730|Ga0181417_1010097 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2437 | Open in IMG/M |
| 3300017731|Ga0181416_1011214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 2128 | Open in IMG/M |
| 3300017731|Ga0181416_1059709 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 901 | Open in IMG/M |
| 3300017733|Ga0181426_1005504 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2480 | Open in IMG/M |
| 3300017733|Ga0181426_1005567 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2467 | Open in IMG/M |
| 3300017735|Ga0181431_1154389 | Not Available | 510 | Open in IMG/M |
| 3300017737|Ga0187218_1025002 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1548 | Open in IMG/M |
| 3300017737|Ga0187218_1149635 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 552 | Open in IMG/M |
| 3300017738|Ga0181428_1051759 | Not Available | 956 | Open in IMG/M |
| 3300017738|Ga0181428_1147423 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 550 | Open in IMG/M |
| 3300017739|Ga0181433_1124075 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 617 | Open in IMG/M |
| 3300017744|Ga0181397_1109140 | Not Available | 724 | Open in IMG/M |
| 3300017757|Ga0181420_1097449 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 907 | Open in IMG/M |
| 3300017757|Ga0181420_1178326 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 625 | Open in IMG/M |
| 3300017760|Ga0181408_1003523 | Not Available | 4620 | Open in IMG/M |
| 3300017760|Ga0181408_1048085 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1145 | Open in IMG/M |
| 3300017760|Ga0181408_1173103 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 552 | Open in IMG/M |
| 3300017764|Ga0181385_1151593 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 704 | Open in IMG/M |
| 3300017765|Ga0181413_1014060 | Not Available | 2495 | Open in IMG/M |
| 3300017765|Ga0181413_1018947 | Not Available | 2157 | Open in IMG/M |
| 3300017765|Ga0181413_1143418 | Not Available | 721 | Open in IMG/M |
| 3300017772|Ga0181430_1165607 | Not Available | 639 | Open in IMG/M |
| 3300017773|Ga0181386_1081884 | Not Available | 1016 | Open in IMG/M |
| 3300017773|Ga0181386_1259487 | Not Available | 513 | Open in IMG/M |
| 3300017775|Ga0181432_1008716 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2426 | Open in IMG/M |
| 3300017776|Ga0181394_1196227 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 616 | Open in IMG/M |
| 3300017779|Ga0181395_1095257 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 955 | Open in IMG/M |
| 3300017781|Ga0181423_1024497 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2462 | Open in IMG/M |
| 3300017782|Ga0181380_1075368 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1184 | Open in IMG/M |
| 3300017783|Ga0181379_1016683 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3012 | Open in IMG/M |
| 3300017786|Ga0181424_10201966 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 842 | Open in IMG/M |
| 3300017786|Ga0181424_10424150 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 539 | Open in IMG/M |
| 3300018420|Ga0181563_10095749 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1953 | Open in IMG/M |
| 3300022046|Ga0224897_100113 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2039 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10553375 | Not Available | 522 | Open in IMG/M |
| 3300024262|Ga0210003_1072205 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1658 | Open in IMG/M |
| 3300025138|Ga0209634_1029045 | Not Available | 2953 | Open in IMG/M |
| 3300025138|Ga0209634_1236277 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 671 | Open in IMG/M |
| 3300025138|Ga0209634_1243686 | Not Available | 655 | Open in IMG/M |
| 3300025632|Ga0209194_1065263 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 996 | Open in IMG/M |
| 3300025810|Ga0208543_1062803 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 905 | Open in IMG/M |
| 3300025816|Ga0209193_1124425 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 620 | Open in IMG/M |
| 3300025849|Ga0209603_1347988 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 502 | Open in IMG/M |
| 3300027779|Ga0209709_10089274 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1647 | Open in IMG/M |
| 3300027779|Ga0209709_10098625 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1536 | Open in IMG/M |
| 3300027779|Ga0209709_10099991 | Not Available | 1521 | Open in IMG/M |
| 3300027779|Ga0209709_10345333 | Not Available | 613 | Open in IMG/M |
| 3300028598|Ga0265306_10198889 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1062 | Open in IMG/M |
| 3300028600|Ga0265303_10189106 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1569 | Open in IMG/M |
| 3300028600|Ga0265303_10542918 | Not Available | 938 | Open in IMG/M |
| 3300031252|Ga0307494_1033721 | Not Available | 561 | Open in IMG/M |
| 3300031519|Ga0307488_10706378 | Not Available | 570 | Open in IMG/M |
| 3300033742|Ga0314858_103904 | Not Available | 721 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 42.16% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 14.71% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 8.82% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.88% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 3.92% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 3.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.94% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 2.94% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 2.94% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.96% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.96% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.96% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.98% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.98% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.98% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300005078 | Microbial Community from Halfdan Field MHBA5 | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300005882 | Hydrocarbon microbial community from Halfdan Field MHF | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007896 | Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3 | Environmental | Open in IMG/M |
| 3300007907 | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_3 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300022046 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 (v2) | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031252 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SW 0.2 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100140772 | 3300000101 | Marine | MSDSMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGTV* |
| DelMOSum2010_100264026 | 3300000101 | Marine | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNNTV* |
| DelMOSum2010_100373313 | 3300000101 | Marine | LNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGTV* |
| DelMOSum2010_100435252 | 3300000101 | Marine | MSDTMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGTV* |
| DelMOSum2010_101238644 | 3300000101 | Marine | MSDSMNDDVEKTLADPKHPIWKIMLGLVAVLSALRMNGTV* |
| DelMOSum2010_101354352 | 3300000101 | Marine | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGTV* |
| DelMOSum2010_101477073 | 3300000101 | Marine | MSDTMNDDVEKTLADPKHPIWKIMLGLVAILSALWMNGTV* |
| DelMOSum2011_100215895 | 3300000115 | Marine | LNDDVEKTLADPKHPIWKVMLGLVAILSALWMNGTV* |
| DelMOSum2011_100321096 | 3300000115 | Marine | MSDSMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGTV* |
| JGI24006J15134_100727222 | 3300001450 | Marine | MINMNDDVEKTLADPKHPIWKIMLGLVAVLSALWINGN* |
| Ga0070770_102170302 | 3300005078 | Water | VITMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGTV* |
| Ga0070770_102267024 | 3300005078 | Water | CVIFMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGTV* |
| Ga0072334_104432915 | 3300005086 | Water | MSDTMNDEVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV* |
| Ga0080455_10293274 | 3300005882 | Water | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV* |
| Ga0080455_10297264 | 3300005882 | Water | MNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGSV* |
| Ga0080455_11028363 | 3300005882 | Water | MNDDVEKTLADPKHPIYKICLGLIALLSALWMNGSV* |
| Ga0080455_11133523 | 3300005882 | Water | DDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV* |
| Ga0075443_102477902 | 3300006165 | Marine | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWINGN* |
| Ga0075461_102143252 | 3300006637 | Aqueous | MINMNDDVEKTLADPKHPIWKVMLGLVAILSALWMNNTV* |
| Ga0111484_10075522 | 3300007896 | Sediment | MNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGTV* |
| Ga0111484_10460032 | 3300007896 | Sediment | MSDSMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNSN* |
| Ga0111546_1014753 | 3300007907 | Sediment | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGSV* |
| Ga0111546_1029212 | 3300007907 | Sediment | MNDDVEKTLADPKHPIYKICLGLIALLSALWINSN* |
| Ga0115566_103395921 | 3300009071 | Pelagic Marine | SKIIMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGSV* |
| Ga0114918_101436924 | 3300009149 | Deep Subsurface | MINMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGSV* |
| Ga0114918_102949352 | 3300009149 | Deep Subsurface | MLIKMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGTV* |
| Ga0114994_102196351 | 3300009420 | Marine | MSDDSVEKTLADPKHPIWKVMLGLVAVLSAIWIQAN* |
| Ga0114994_104906313 | 3300009420 | Marine | MNDDVEKTLADPKHPIWKIMLGLVAVLSALWINGN* |
| Ga0114994_108380743 | 3300009420 | Marine | MSDDSVEKTLADPKHPIWKVMLGLVAVLSAIWINSN* |
| Ga0114997_101410515 | 3300009425 | Marine | MNDDVEKTLADPKHPIWKIMLGLVAILSALWIQAN* |
| Ga0114997_102099602 | 3300009425 | Marine | MNDDVEKTLADPKHPIWKIMLGLVAVLSALWINSN* |
| Ga0114997_102254672 | 3300009425 | Marine | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWINSN* |
| Ga0115545_11688281 | 3300009433 | Pelagic Marine | LIMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGSV* |
| Ga0115564_104770602 | 3300009505 | Pelagic Marine | MNDEVEKTLADPKHPIWKIMLGLVAVLSALWMNGTV* |
| Ga0115000_110321662 | 3300009705 | Marine | MSDDSVEKTLADPKHPIWKAMLGLVAVLSAIWIQAN* |
| Ga0129348_13081952 | 3300010296 | Freshwater To Marine Saline Gradient | MSDTMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNNTV* |
| Ga0151677_10120284 | 3300011258 | Marine | MINMNDEVEKTLADPKHPIWKVMLGLVAVLSALWMNNTV* |
| Ga0163179_102952502 | 3300012953 | Seawater | MNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNNSV* |
| Ga0180120_103303262 | 3300017697 | Freshwater To Marine Saline Gradient | MSDTMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGTV |
| Ga0181387_10319242 | 3300017709 | Seawater | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNNTV |
| Ga0181403_10345512 | 3300017710 | Seawater | MDDDLEKTLADPKHPIWKVMLGLVAVLSALWMNNTV |
| Ga0181391_11180863 | 3300017713 | Seawater | IMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNNTV |
| Ga0181412_10856741 | 3300017714 | Seawater | MNDDVEKTLADPKHPIWNVMLGLVAVLSALWMNNTV |
| Ga0181383_10425811 | 3300017720 | Seawater | GRIRMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV |
| Ga0181383_10685342 | 3300017720 | Seawater | MNNDVEKTLADPKHPIWKIMLGLVAILSALWINGN |
| Ga0181381_10452493 | 3300017726 | Seawater | LNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNSTV |
| Ga0181419_10124942 | 3300017728 | Seawater | MSDTMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV |
| Ga0181419_10791981 | 3300017728 | Seawater | TRWPTVNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV |
| Ga0181396_10057151 | 3300017729 | Seawater | RRYIMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNNTV |
| Ga0181417_10100971 | 3300017730 | Seawater | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNST |
| Ga0181416_10112144 | 3300017731 | Seawater | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWINSTV |
| Ga0181416_10597091 | 3300017731 | Seawater | MNDDVEKTLADPKYPIWKVMLGLVAVLSALWMNSTV |
| Ga0181426_10055044 | 3300017733 | Seawater | VNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV |
| Ga0181426_10055677 | 3300017733 | Seawater | MSDIMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV |
| Ga0181431_11543891 | 3300017735 | Seawater | VIEMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNSTV |
| Ga0187218_10250025 | 3300017737 | Seawater | MDDDVEKTLADPKHPIWKVMLGLVAVLSALWMNNTV |
| Ga0187218_11496351 | 3300017737 | Seawater | IIMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGSV |
| Ga0181428_10517593 | 3300017738 | Seawater | MNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNNTV |
| Ga0181428_11474232 | 3300017738 | Seawater | MNDDVEKTLADPKHPIWKAILGLVALLSALWMNNTV |
| Ga0181433_11240752 | 3300017739 | Seawater | LNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGSV |
| Ga0181397_11091403 | 3300017744 | Seawater | MNDDVEKTLADPKHPIWKVMLGLVEVLSALWMNSTV |
| Ga0181420_10974491 | 3300017757 | Seawater | IKVLNDMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNNTV |
| Ga0181420_11783262 | 3300017757 | Seawater | SLNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGTV |
| Ga0181408_100352312 | 3300017760 | Seawater | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSSV |
| Ga0181408_10480852 | 3300017760 | Seawater | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMYNTV |
| Ga0181408_11731032 | 3300017760 | Seawater | MSDIMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGTV |
| Ga0181385_11515933 | 3300017764 | Seawater | MLIKMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGSV |
| Ga0181413_10140604 | 3300017765 | Seawater | MNDNVEKTLADPKHPIWKIMLGLVAVLSALWMNNTV |
| Ga0181413_10189471 | 3300017765 | Seawater | IKMSDTMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV |
| Ga0181413_11434182 | 3300017765 | Seawater | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTI |
| Ga0181430_11656071 | 3300017772 | Seawater | MLQAIRMNDDVEKTLADPKHPIWKIMLGLVAVLSALWINGN |
| Ga0181386_10818841 | 3300017773 | Seawater | MLINMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV |
| Ga0181386_12594873 | 3300017773 | Seawater | NDDVEKTLADPKHPIYKVMLAMIALLSALWMNNTV |
| Ga0181432_10087164 | 3300017775 | Seawater | MSDSMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGSV |
| Ga0181394_11962271 | 3300017776 | Seawater | NKSKIIMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNNTV |
| Ga0181395_10952571 | 3300017779 | Seawater | SKIIMNDDVEKTLADPKHPRWKVMLGLVAVLSALWMNNTV |
| Ga0181423_10244979 | 3300017781 | Seawater | RWPTVNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNSTV |
| Ga0181380_10753683 | 3300017782 | Seawater | LNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNNTV |
| Ga0181379_10166838 | 3300017783 | Seawater | MLINMNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGSV |
| Ga0181424_102019661 | 3300017786 | Seawater | LNDDIEKTLADPKHPIWKVMLGLVAVLSALWMNGTV |
| Ga0181424_104241502 | 3300017786 | Seawater | MNDDVEKTLADPKHPIWKVMLGLVGILSALWINGTV |
| Ga0181563_100957493 | 3300018420 | Salt Marsh | MLINMNDDVEKTLADPKHPIWKVMLGLVAILSALWMNNTV |
| Ga0224897_1001133 | 3300022046 | Seawater | MNDDVEKTLADPKHPIWKVILGLVAVLSALWMNNTV |
| (restricted) Ga0233412_105533752 | 3300023210 | Seawater | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWINGN |
| Ga0210003_10722054 | 3300024262 | Deep Subsurface | MINMNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGSV |
| Ga0209634_10290456 | 3300025138 | Marine | MINMNDDVEKTLADPKHPIWKVMLGLVAVLSALWINGN |
| Ga0209634_12362773 | 3300025138 | Marine | MDDDVEKTLADPKHPIWKIMLGLVAVLSALWINGN |
| Ga0209634_12436861 | 3300025138 | Marine | YKMINMNDDVEKTLADPKHPIWKVMLGLVAVLSAIWINGN |
| Ga0209194_10652631 | 3300025632 | Pelagic Marine | LNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGTV |
| Ga0208543_10628032 | 3300025810 | Aqueous | MINMNDDVEKTLADPKHPIWKVMLGLVAILSALWMNNTV |
| Ga0209193_11244253 | 3300025816 | Pelagic Marine | MNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGTV |
| Ga0209603_13479882 | 3300025849 | Pelagic Marine | MNDDVEKTLADPKHPIWKVMLGLVAVLSALWMNGSV |
| Ga0209709_100892742 | 3300027779 | Marine | MSDDSVEKTLADPKHPIWKVMLGLVAVLSAIWIQAN |
| Ga0209709_100986255 | 3300027779 | Marine | MNDDVEKTLADPKHPIWKIMLGLVAILSALWIQAN |
| Ga0209709_100999915 | 3300027779 | Marine | IIMNDDVEKTLADPKHPIWKICLGLVAILSALWINSN |
| Ga0209709_103453333 | 3300027779 | Marine | MSDDSVEKTLADPKHPIWKVMLGLVAVLSAIWINSN |
| Ga0265306_101988892 | 3300028598 | Sediment | MNDDVEKTLADPKHPIWKIMLGLVAVLSALWMNGSV |
| Ga0265303_101891064 | 3300028600 | Sediment | MNDDVEKTLADPKHPIWKIMLGLVAILSALWMNGSV |
| Ga0265303_105429185 | 3300028600 | Sediment | MNDDVEKTLADPKHPIWKVMLGLIAVLSALWMNSTV |
| Ga0307494_10337212 | 3300031252 | Sackhole Brine | MNDDVEKTLADPKHPIWKVMLGLVAVLSAIWINGN |
| Ga0307488_107063783 | 3300031519 | Sackhole Brine | ATHQFKMINMNDDVEKTLADPKHPIWKVMLGLVTVLSAIWINGN |
| Ga0314858_103904_512_628 | 3300033742 | Sea-Ice Brine | MIDMNDDVEKTLADPKHPIWKVMLGLVAVLSALWINGN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |