| Basic Information | |
|---|---|
| Family ID | F101796 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 46 residues |
| Representative Sequence | GNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 93.14 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.333 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.706 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.176 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.21% β-sheet: 0.00% Coil/Unstructured: 40.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 9.80 |
| PF01812 | 5-FTHF_cyc-lig | 7.84 |
| PF00211 | Guanylate_cyc | 5.88 |
| PF00072 | Response_reg | 4.90 |
| PF00528 | BPD_transp_1 | 3.92 |
| PF08241 | Methyltransf_11 | 3.92 |
| PF13426 | PAS_9 | 2.94 |
| PF00118 | Cpn60_TCP1 | 2.94 |
| PF00027 | cNMP_binding | 2.94 |
| PF02518 | HATPase_c | 2.94 |
| PF01625 | PMSR | 2.94 |
| PF13185 | GAF_2 | 2.94 |
| PF00903 | Glyoxalase | 1.96 |
| PF14366 | DUF4410 | 1.96 |
| PF01263 | Aldose_epim | 0.98 |
| PF00924 | MS_channel | 0.98 |
| PF01841 | Transglut_core | 0.98 |
| PF02769 | AIRS_C | 0.98 |
| PF07517 | SecA_DEAD | 0.98 |
| PF12710 | HAD | 0.98 |
| PF01663 | Phosphodiest | 0.98 |
| PF07883 | Cupin_2 | 0.98 |
| PF13424 | TPR_12 | 0.98 |
| PF16655 | PhoD_N | 0.98 |
| PF00296 | Bac_luciferase | 0.98 |
| PF04909 | Amidohydro_2 | 0.98 |
| PF12773 | DZR | 0.98 |
| PF13671 | AAA_33 | 0.98 |
| PF00005 | ABC_tran | 0.98 |
| PF02129 | Peptidase_S15 | 0.98 |
| PF02826 | 2-Hacid_dh_C | 0.98 |
| PF13545 | HTH_Crp_2 | 0.98 |
| PF01738 | DLH | 0.98 |
| PF09423 | PhoD | 0.98 |
| PF13592 | HTH_33 | 0.98 |
| PF09391 | DUF2000 | 0.98 |
| PF13191 | AAA_16 | 0.98 |
| PF00106 | adh_short | 0.98 |
| PF00989 | PAS | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 9.80 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 7.84 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 5.88 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 2.94 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.94 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 0.98 |
| COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 0.98 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.98 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT01C64GO | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 2189573001|GZR05M102IWAP6 | Not Available | 516 | Open in IMG/M |
| 3300000881|JGI10215J12807_1189986 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300004114|Ga0062593_100986761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. FACHB-36 | 862 | Open in IMG/M |
| 3300004139|Ga0058897_10995848 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
| 3300004480|Ga0062592_101071790 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005332|Ga0066388_108789372 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005438|Ga0070701_10855208 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005439|Ga0070711_100295283 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
| 3300005440|Ga0070705_101952420 | Not Available | 500 | Open in IMG/M |
| 3300005441|Ga0070700_100184871 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1453 | Open in IMG/M |
| 3300005467|Ga0070706_100251088 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300005536|Ga0070697_100446769 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300005536|Ga0070697_100900496 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005549|Ga0070704_102315228 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira → Leptospira weilii | 500 | Open in IMG/M |
| 3300005615|Ga0070702_100012761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4225 | Open in IMG/M |
| 3300005618|Ga0068864_101835267 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005713|Ga0066905_100079869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2145 | Open in IMG/M |
| 3300005843|Ga0068860_101212194 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300005878|Ga0075297_1011623 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 863 | Open in IMG/M |
| 3300006047|Ga0075024_100350934 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300006058|Ga0075432_10574193 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006172|Ga0075018_10478186 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300006755|Ga0079222_10025716 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300006806|Ga0079220_10153445 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300006847|Ga0075431_101567081 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300007004|Ga0079218_11832957 | Not Available | 682 | Open in IMG/M |
| 3300009101|Ga0105247_10474367 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300009177|Ga0105248_10366387 | Not Available | 1622 | Open in IMG/M |
| 3300010048|Ga0126373_12558224 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300010301|Ga0134070_10265772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
| 3300010358|Ga0126370_12643629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300010358|Ga0126370_12643630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300010360|Ga0126372_10442345 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300010366|Ga0126379_13435316 | Not Available | 530 | Open in IMG/M |
| 3300010376|Ga0126381_100288682 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
| 3300010397|Ga0134124_10096417 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
| 3300010398|Ga0126383_11883122 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300010400|Ga0134122_10273855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300010400|Ga0134122_13163704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300011119|Ga0105246_10875858 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300011271|Ga0137393_11564558 | Not Available | 549 | Open in IMG/M |
| 3300012204|Ga0137374_10028993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6088 | Open in IMG/M |
| 3300012210|Ga0137378_11329968 | Not Available | 634 | Open in IMG/M |
| 3300012211|Ga0137377_10480605 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300012349|Ga0137387_10986804 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012360|Ga0137375_10012274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10150 | Open in IMG/M |
| 3300012918|Ga0137396_10556924 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300012918|Ga0137396_11104226 | Not Available | 567 | Open in IMG/M |
| 3300012925|Ga0137419_10150261 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300012927|Ga0137416_10581963 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300012944|Ga0137410_10009441 | All Organisms → cellular organisms → Bacteria | 6603 | Open in IMG/M |
| 3300012951|Ga0164300_10492322 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300012986|Ga0164304_11788863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300013102|Ga0157371_10578030 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 834 | Open in IMG/M |
| 3300014299|Ga0075303_1116307 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300015245|Ga0137409_10278844 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300016357|Ga0182032_10269961 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300018053|Ga0184626_10002012 | All Organisms → cellular organisms → Bacteria | 7356 | Open in IMG/M |
| 3300018071|Ga0184618_10080680 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300018078|Ga0184612_10119947 | Not Available | 1376 | Open in IMG/M |
| 3300018084|Ga0184629_10306819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
| 3300019458|Ga0187892_10208728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1037 | Open in IMG/M |
| 3300019889|Ga0193743_1228520 | Not Available | 563 | Open in IMG/M |
| 3300020021|Ga0193726_1162296 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300020579|Ga0210407_10602106 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300020581|Ga0210399_10256628 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300021073|Ga0210378_10010921 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3838 | Open in IMG/M |
| 3300021403|Ga0210397_10381317 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300021479|Ga0210410_10409870 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300022534|Ga0224452_1078796 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300022534|Ga0224452_1243577 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300022694|Ga0222623_10111370 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300025885|Ga0207653_10321383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 602 | Open in IMG/M |
| 3300025900|Ga0207710_10340913 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300025910|Ga0207684_10376474 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300025917|Ga0207660_10111718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2057 | Open in IMG/M |
| 3300025921|Ga0207652_10002301 | All Organisms → cellular organisms → Bacteria | 16191 | Open in IMG/M |
| 3300025922|Ga0207646_10254918 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300025941|Ga0207711_10203051 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300026075|Ga0207708_10208920 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300026496|Ga0257157_1056728 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300027643|Ga0209076_1168347 | Not Available | 609 | Open in IMG/M |
| 3300027787|Ga0209074_10159969 | Not Available | 817 | Open in IMG/M |
| 3300027787|Ga0209074_10396739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
| 3300027903|Ga0209488_10118690 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300027903|Ga0209488_10148752 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
| 3300027915|Ga0209069_10515644 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300028380|Ga0268265_12002776 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300028381|Ga0268264_11183550 | Not Available | 774 | Open in IMG/M |
| 3300028715|Ga0307313_10067152 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300028807|Ga0307305_10228481 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 852 | Open in IMG/M |
| 3300030336|Ga0247826_11307636 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 584 | Open in IMG/M |
| 3300031455|Ga0307505_10634082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300031820|Ga0307473_10872855 | Not Available | 647 | Open in IMG/M |
| 3300032043|Ga0318556_10064758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1797 | Open in IMG/M |
| 3300032067|Ga0318524_10051967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1954 | Open in IMG/M |
| 3300032180|Ga0307471_100938657 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300032205|Ga0307472_101585873 | Not Available | 642 | Open in IMG/M |
| 3300033475|Ga0310811_10834211 | Not Available | 851 | Open in IMG/M |
| 3300033500|Ga0326730_1052441 | Not Available | 783 | Open in IMG/M |
| 3300034090|Ga0326723_0295607 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_02577780 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MIVAVPAATVLQESVRLLLEHRRALARRDLRHHPQRLVV |
| FD2_03387230 | 2189573001 | Grass Soil | GNHALGVLGMIIAVPVATVLHGDGASPPRAPPVLARRDLRRRPARLVA |
| JGI10215J12807_11899861 | 3300000881 | Soil | LGVLGMIIAVPVATVLQETVRLLLEHRRVLARRSLRA* |
| Ga0062593_1009867613 | 3300004114 | Soil | MIIAVPVATVLQETARLLLEHRRVLARRGLSHHPERLVV* |
| Ga0058897_109958481 | 3300004139 | Forest Soil | ALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRHHAERPVV* |
| Ga0062592_1010717902 | 3300004480 | Soil | NHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRSLRA* |
| Ga0066388_1087893722 | 3300005332 | Tropical Forest Soil | VGNHALGILGMIVAVPLATVLQETTRLLLEHRRVLARREPERQPGHVIV* |
| Ga0070701_108552081 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | NHALGVLGMIIAVPVATVLQETARLLLDHRRVLARHGLSHHTERPVV* |
| Ga0070711_1002952832 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GSVVVGSHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRVRRRDPERVVA* |
| Ga0070705_1019524202 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LGMIIAVPVATVLQETARLLLEHRRVLARHHQSHHPERLVI* |
| Ga0070700_1001848712 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | HALGVLGMIVAVPAATVLQESVRLLLEHRRALARRDLRHHPQRLVV* |
| Ga0070706_1002510883 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA* |
| Ga0070697_1004467692 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRHHPERLVI* |
| Ga0070697_1009004962 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGSVVVGNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRHLRTGGGRLGG* |
| Ga0070704_1023152281 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLLGSVVVGNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA* |
| Ga0070702_1000127616 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGSVVVGNHALGVLGMIVAVPAATVLQESVRLLLEHRRALARRDLRHHPQRLVV* |
| Ga0068864_1018352672 | 3300005618 | Switchgrass Rhizosphere | LGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLSHHPERLVV* |
| Ga0066905_1000798691 | 3300005713 | Tropical Forest Soil | LLLGSVVVGNHALGILGMIVAVPVATVLQETTRLLLEHRRVLARREPRRQPGHVIV* |
| Ga0068860_1012121942 | 3300005843 | Switchgrass Rhizosphere | HALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDPKRLVV* |
| Ga0075297_10116231 | 3300005878 | Rice Paddy Soil | SHAAGVLGMIVAVPVATVLQETVRLLLEHRRVLARRRRPPERLVV* |
| Ga0075024_1003509341 | 3300006047 | Watersheds | GMIIAVPAATVLQETVRLLLEHRRVLARRDLRGRPGRLAA* |
| Ga0075432_105741932 | 3300006058 | Populus Rhizosphere | SVVVGSHALGVLGMIIAVPVATVLQETARLLLEHRRVLAQRDLRHHPERLVI* |
| Ga0075018_104781862 | 3300006172 | Watersheds | PALLLGSVVVGNHALGVLGMIIAVPAATVLQETVRLLLEHRRVLARRDLRGRPGRLAA* |
| Ga0079222_100257161 | 3300006755 | Agricultural Soil | SVVVGNHALGVLGMIVAVPAATVLQESVRLLLEHRRALARRDLRHHPQRLVV* |
| Ga0079220_101534452 | 3300006806 | Agricultural Soil | ALLLGSVVVGSHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRVRRPDPERVVA* |
| Ga0075431_1015670811 | 3300006847 | Populus Rhizosphere | ALLLGSVVVGNHALGVLGMIVAVPVATVLQETARLLLEHRRVLARRRLRSNAGRVGG* |
| Ga0079218_118329571 | 3300007004 | Agricultural Soil | MIIAVPVATVLQETARLLLEHRRVLARHQNPERVVV |
| Ga0105247_104743671 | 3300009101 | Switchgrass Rhizosphere | VLGMIIAVPVATVLQETARLLLEHRRVLARRDLSHHPERLVV* |
| Ga0105248_103663872 | 3300009177 | Switchgrass Rhizosphere | PALLLGSVVVGNHALGVLGMIIAVPVATVLQETARLLLDHRRVLARHGLSHHTERPVV* |
| Ga0126373_125582241 | 3300010048 | Tropical Forest Soil | VPVATVLQETTRLLLEHRRVLARREPRRLPGHLVV* |
| Ga0134070_102657721 | 3300010301 | Grasslands Soil | VVGNHALGVLGMVVAVPVATVLQETARLLLEHRRVLARRDSRPHPERLLV* |
| Ga0126370_126436291 | 3300010358 | Tropical Forest Soil | LGSVVVGNHALGILGMIVAVPLATVLQETTRLLLEHRRVLARREPQRQPGHVIV* |
| Ga0126370_126436301 | 3300010358 | Tropical Forest Soil | LGSVVVGNHALGILGMIVAVPLATVLQETTRLLLEHRRVLARREPERQPGHVIV* |
| Ga0126372_104423452 | 3300010360 | Tropical Forest Soil | VVGNHALGILGMIVAVPLATVLQETTRLLLEHRRVLARREPQRQPGHVIV* |
| Ga0126379_134353161 | 3300010366 | Tropical Forest Soil | LLLGSVVIGSHAFGVLGMIIAIPVATVLQETARLVLEHRRVLARHDRRRSAERPIVV* |
| Ga0126381_1002886821 | 3300010376 | Tropical Forest Soil | GILGMIVAVPVATVLQETARLLLEHRRVLARHDVRRPPARMIV* |
| Ga0134124_100964171 | 3300010397 | Terrestrial Soil | ALLLGSVVVGSHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRQRQERLVL* |
| Ga0126383_118831222 | 3300010398 | Tropical Forest Soil | ILGMIVAVPLATVLQETTRLLLEHRRVLARREPRHSPSHVIV* |
| Ga0134122_102738551 | 3300010400 | Terrestrial Soil | VLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRQRQERLVL* |
| Ga0134122_131637042 | 3300010400 | Terrestrial Soil | LGVLGMIIAVPVATVLQETARLLLEHRRVLARRGLRQHPERLIV* |
| Ga0105246_108758582 | 3300011119 | Miscanthus Rhizosphere | VVKTPARGVRGSIFAVPLAPALQETGRLLLDPRRVLARRSLRA* |
| Ga0137393_115645582 | 3300011271 | Vadose Zone Soil | ALLLGSVVVGNHALGVLGMIIAVPVATVLQETVRLLLEHRRMLARRDLRGRPGRLVA* |
| Ga0137374_100289932 | 3300012204 | Vadose Zone Soil | VVVGNHALGVLGMIVAVPAATVLQETVRLLLEHRRILARRSLRSDAGRVGG* |
| Ga0137378_113299682 | 3300012210 | Vadose Zone Soil | PVATVLQETVRLLLEHRRMLARRDLRGRPERLVA* |
| Ga0137377_104806051 | 3300012211 | Vadose Zone Soil | AVPVATVLQETVRLLLEHRRMLARRDLRGRPERLVA* |
| Ga0137387_109868043 | 3300012349 | Vadose Zone Soil | LGSVVVGSHALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRHDPKRLVV* |
| Ga0137375_1001227410 | 3300012360 | Vadose Zone Soil | VVVGNHALGVLGVIVAVPAATVLQETVRLLLEHRRILARRSLRSDAGRVGG* |
| Ga0137396_105569242 | 3300012918 | Vadose Zone Soil | LGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRHDPKRLVV* |
| Ga0137396_111042261 | 3300012918 | Vadose Zone Soil | IAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA* |
| Ga0137419_101502611 | 3300012925 | Vadose Zone Soil | AVPVATVLQETARLLLEHRRVLARRDLRHDPKRLVV* |
| Ga0137416_105819632 | 3300012927 | Vadose Zone Soil | IIAVPVATVLQETVRLLLEHRRMLARRDLRGRPGRLVA* |
| Ga0137410_100094418 | 3300012944 | Vadose Zone Soil | VVVGNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA* |
| Ga0164300_104923222 | 3300012951 | Soil | MIVAVPAATVLQESVRLLLEHRRALARRDLRHRPQRLVV* |
| Ga0164304_117888631 | 3300012986 | Soil | VLGMIVAVPAATVLQESVRLLLEHRRALARRDLRHHPQRLVV* |
| Ga0157371_105780302 | 3300013102 | Corn Rhizosphere | LGVLGMIVAVPAATVLQESVRLLLEHRRALARRDLRHHPQRLVV* |
| Ga0075303_11163071 | 3300014299 | Natural And Restored Wetlands | NHALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRRHPGRLVV* |
| Ga0137409_102788443 | 3300015245 | Vadose Zone Soil | LGSVVVGNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA* |
| Ga0182032_102699613 | 3300016357 | Soil | ALLLGSVVVGNHALGILGMIVAVPLATVLQETTRLLLEHRRVLARREPQRQPGHVIV |
| Ga0184626_100020125 | 3300018053 | Groundwater Sediment | SVVVGSHALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRHHPERPIV |
| Ga0184618_100806801 | 3300018071 | Groundwater Sediment | ALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRHDPKRLVV |
| Ga0184612_101199472 | 3300018078 | Groundwater Sediment | GSHALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRLRPERPVV |
| Ga0184629_103068191 | 3300018084 | Groundwater Sediment | LGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRLRPERPVV |
| Ga0187892_102087283 | 3300019458 | Bio-Ooze | VVVGNHALGVLGMIVAVPAATVLQETVRLLLEHRRVLARRSLRSDAGRLGG |
| Ga0193743_12285202 | 3300019889 | Soil | LLGSVVVGSHALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDLRHHPERPIV |
| Ga0193726_11622963 | 3300020021 | Soil | VVGNHALGVLGMIIAVPAATVLQETVRLLLEHRRVLARRDLRGRPERLVA |
| Ga0210407_106021061 | 3300020579 | Soil | VLGMIIAVPVATVLQETVRLLLEHRRVLARRVRRRGPERLVA |
| Ga0210399_102566283 | 3300020581 | Soil | MIIAVPVATVLQETARLLLEHRRVLARRDLRHHAERPVV |
| Ga0210378_100109214 | 3300021073 | Groundwater Sediment | GMIIAVPVATVLQETARLLLEHRRVLARRDLRHHPERPIV |
| Ga0210397_103813171 | 3300021403 | Soil | LGMIIAVPVATVLQETVRLLLEHRRVLARRVRRRGPERLVA |
| Ga0210410_104098701 | 3300021479 | Soil | GSHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRVRRRGPERLVA |
| Ga0224452_10787961 | 3300022534 | Groundwater Sediment | AVPVATVLQETARLLLEHRRVLARRDLRLRPERPVV |
| Ga0224452_12435772 | 3300022534 | Groundwater Sediment | AVPVATVLQETARLLLEHRRVLARRDLRHDPKRLVV |
| Ga0222623_101113701 | 3300022694 | Groundwater Sediment | MIIAVPVATVLQETARLLLEHRRVLARRDLRLRPERPVV |
| Ga0207653_103213832 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | TAPIFIAVPVATVLQETARLLLEHRRVLARRGLSRHPERLVV |
| Ga0207710_103409131 | 3300025900 | Switchgrass Rhizosphere | VLGMIIAVPVATVLQETARLLLEHRRVLARRDLSHHPERLVV |
| Ga0207684_103764741 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VVGNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA |
| Ga0207660_101117181 | 3300025917 | Corn Rhizosphere | LGMIVAVPAATVLQESVRLLLEHRRALARRDLRHHPQRLVV |
| Ga0207652_100023011 | 3300025921 | Corn Rhizosphere | GMIVAVPAATVLQESVRLLLEHRRALARRDLRHHPQRLVV |
| Ga0207646_102549182 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LGSVVVGNHALGVLGMIVAVPVATVLQETVRLLLEHRRVLARRSLRA |
| Ga0207711_102030512 | 3300025941 | Switchgrass Rhizosphere | MIIAVPVATVLQETARLLLEHRRVLARRDLSHHPERLVV |
| Ga0207708_102089202 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | NHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRSLRA |
| Ga0257157_10567282 | 3300026496 | Soil | GNHALGVLGMIIAVPAATVLQETVRLLLEHRRVLARRDLRGRPERLVA |
| Ga0209076_11683472 | 3300027643 | Vadose Zone Soil | PALLLGSVVVGNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA |
| Ga0209074_101599692 | 3300027787 | Agricultural Soil | LGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDRRRRPEGVAA |
| Ga0209074_103967391 | 3300027787 | Agricultural Soil | ALGVLGMIVAVPAATVLQESVRLLLEHRRALARRDLRHRPQRLVV |
| Ga0209488_101186903 | 3300027903 | Vadose Zone Soil | VGNHALGVLGMIIAVPVATVLQETVRLLLEHRRMLARRDLRGRPGRLVA |
| Ga0209488_101487521 | 3300027903 | Vadose Zone Soil | VGNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA |
| Ga0209069_105156442 | 3300027915 | Watersheds | GVLGMIIAVPAATVLQETVRLLLEHRRVLARRDLRGRPGRLAA |
| Ga0268265_120027761 | 3300028380 | Switchgrass Rhizosphere | VLGMIIAVPVATVLQETARLLLEHRRVLARRDLRHRPERLVV |
| Ga0268264_111835501 | 3300028381 | Switchgrass Rhizosphere | GSHALGVLGMIIAVPVATVLQETARLLLEHRRVLARRDPKRLVV |
| Ga0307313_100671521 | 3300028715 | Soil | IAVPVATVLQETARLLLEHRRVLARRDLRHDPKRLVV |
| Ga0307305_102284811 | 3300028807 | Soil | SVVVGNHALGVLGMIVAVPVATVLQETVRLLLEHRRVLARRSLRSETGRLGG |
| Ga0247826_113076361 | 3300030336 | Soil | VVVGNHALGVLGMIVAVPAATVLQESVRLLLEHRRALARRDLRHHPQRLVV |
| Ga0307505_106340821 | 3300031455 | Soil | IIAVPVATVLQETVRLLLEHRRVLARRDLRQRQERLVL |
| Ga0307473_108728552 | 3300031820 | Hardwood Forest Soil | MIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA |
| Ga0318556_100647583 | 3300032043 | Soil | TVPLATVLQETTRLLLEHRRVLARREPQRQPGHVIV |
| Ga0318524_100519671 | 3300032067 | Soil | NHALGILGMIVAVPLATVLQETTRLLLEHRRVLARREPQRQPGHVIV |
| Ga0307471_1009386572 | 3300032180 | Hardwood Forest Soil | LLGSVVVGNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA |
| Ga0307472_1015858731 | 3300032205 | Hardwood Forest Soil | IAVPVATVLQETVRLLLEHRRVLARRDLRRRPERLVA |
| Ga0310811_108342111 | 3300033475 | Soil | GSHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDRRRHPERQVA |
| Ga0326730_10524412 | 3300033500 | Peat Soil | GVLGMIIAVPVATVLQETVRLLLEHRRVLARRDRRRRPEGLAA |
| Ga0326723_0295607_3_179 | 3300034090 | Peat Soil | PALLLGSVVVGNHALGVLGMIIAVPVATVLQETVRLLLEHRRVLARRDLRRHPGRLVV |
| ⦗Top⦘ |