Basic Information | |
---|---|
Family ID | F101795 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 37 residues |
Representative Sequence | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKF |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 82.35 % |
% of genes near scaffold ends (potentially truncated) | 98.04 % |
% of genes from short scaffolds (< 2000 bps) | 91.18 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.471 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.314 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.392 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.843 % of family members) |
⦗Top⦘ |
Full Alignment |
---|
Alignment of all the sequences in the family. |
IDLabel .2.4.6.8.10.12.14.16.18.20.22.24.26.28.30.32.34.36.38.40.42.44.46.48 |
Powered by MSAViewer |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% |
Feature Viewer | |||||
Position : 0 Zoom : x 1 Enter the variants Position Original Variant |
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
⦗Top⦘ |
Visualization |
---|
All Organisms Unclassified |
Powered by ApexCharts |
⦗Top⦘ |
Visualization |
---|
Bog Forest Soil Freshwater Sediment Iron-Sulfur Acid Spring Watersheds Vadose Zone Soil Glacier Forefield Soil Grasslands Soil Peatlands Soil Soil Grasslands Soil Soil Soil Hardwood Forest Soil Soil Tropical Peatland Soil Tropical Forest Soil Forest Soil Palsa Biofilm Switchgrass Rhizosphere |
Powered by ApexCharts |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25616J43925_101092571 | 3300002917 | Grasslands Soil | MPHMIPAPGAFIVGVAIFLIVVWDAFEAIILPRRVTRKFR |
Ga0058897_107530892 | 3300004139 | Forest Soil | MPHMIPFPGAFVAGALIFLIVIWDAFEAIILPRRVTRKFR |
Ga0068963_12208982 | 3300004618 | Peatlands Soil | MLRMIPAPGVFIAGVLLFLLVAWDAFEAIILPRRVTRKFR |
Ga0058899_122483851 | 3300004631 | Forest Soil | MPHMIPAPGAFIAGVAIFLIVLWDAFEAIILPRRVTRKFR |
Ga0068864_1012968382 | 3300005618 | Switchgrass Rhizosphere | MPHMIPFPVPFAAGVAIFMIVLWDAFESVILPRRVTRK |
Ga0066788_101046971 | 3300005944 | Soil | MIPVPGAFLTGIAIFFIVIWDAFESVILPRRVTRKFR |
Ga0075018_105081782 | 3300006172 | Watersheds | MPHMIPVPGAFAVGVAIFLIVLWDAFEAIILPRRVTRKF |
Ga0066665_105109301 | 3300006796 | Soil | MLTSPAAFLTGVAILIIVVWDAFEVIILPRRVTRRFRL |
Ga0066665_106188233 | 3300006796 | Soil | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKF |
Ga0073928_100346561 | 3300006893 | Iron-Sulfur Acid Spring | MIPAPGAFLAGIAIFLIVVWDAFESIILPRRVTRKFR |
Ga0073928_108945712 | 3300006893 | Iron-Sulfur Acid Spring | MTSAIPAPGEFLAGVMLFLIVVWDAFEAIILPRRV |
Ga0099793_103903961 | 3300007258 | Vadose Zone Soil | MTSVIPYPGEFVVGVAAFLIVVWDAFEAIILPRRVT |
Ga0099829_112875301 | 3300009038 | Vadose Zone Soil | MPHMIPTPGTFAAGVAIFLIVIWDAFEAIILPRRVTRKF |
Ga0127488_10272061 | 3300010122 | Grasslands Soil | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRK |
Ga0150983_156211852 | 3300011120 | Forest Soil | MILAPGVFIAGVVIFLIVLWDAFEAIILPRRVTRK |
Ga0150983_158922731 | 3300011120 | Forest Soil | MIPAPGAFLAGVAIFLIVLWDAFEAIILPRRVTRK |
Ga0137391_110963453 | 3300011270 | Vadose Zone Soil | MPHMIPAPGAFVAGVAIFLIVLWEAFEAIILPRRVT |
Ga0137383_102451583 | 3300012199 | Vadose Zone Soil | MQHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTR |
Ga0137387_103805361 | 3300012349 | Vadose Zone Soil | MPHMIPAPGAFALGVAIFLIVVWDAFEAVILPRRVT |
Ga0137360_103473801 | 3300012361 | Vadose Zone Soil | MPHMIPAPGAFAAGVALFLIVLWDAFEAIILPRRVTRK |
Ga0134060_12492113 | 3300012410 | Grasslands Soil | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTR |
Ga0137359_102133554 | 3300012923 | Vadose Zone Soil | MTSVIPAPGEFLAGVALFLIVVWDAFEAIILPRRV |
Ga0137419_102618993 | 3300012925 | Vadose Zone Soil | MQHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKFR |
Ga0137416_101358955 | 3300012927 | Vadose Zone Soil | MILAPGVFIAGVVIFLIVIWDAFEAIILPRRVTRK |
Ga0137405_11569243 | 3300015053 | Vadose Zone Soil | MPHMIPAPGAFIAGVATFAIVLWDAFEAIILPRRV |
Ga0167661_10827621 | 3300015167 | Glacier Forefield Soil | MLPSPAAFIAGVAILIIVVWDAFEAIILPRRVTRQFRLN |
Ga0182032_112649811 | 3300016357 | Soil | MIPVPGAFVAGVAVFLVVAWDAFEAIILPRRETREFR |
Ga0182034_104916793 | 3300016371 | Soil | MIPAPGAFIAGLVVFLVVAWDAFEAIILPRRVTRRFRL |
Ga0182037_112209282 | 3300016404 | Soil | MLRMIPAPGVFVAGVVIFLVVVWDAFEAIILPRRV |
Ga0187801_100228706 | 3300017933 | Freshwater Sediment | MPHMIPVPGAFAVGVAIFLIVLWDAFEAIILPRRVT |
Ga0187771_110371312 | 3300018088 | Tropical Peatland | MLRMIPVPGVFLAGIAVFLLVAWDAFEAIILPRRVTRKFRL |
Ga0066662_113163571 | 3300018468 | Grasslands Soil | MPHMIPAPGAFAAGVAIFLIVVWDAFESIILPRRVTRKFR |
Ga0179592_101186571 | 3300020199 | Vadose Zone Soil | MPHMIPAPGAFAAGVAIFVIVVWDAFEAIILPRRVTR |
Ga0210407_114470822 | 3300020579 | Soil | MPHMIPSSGAFAAGAAIFLIVLWDAFEAIILPRRVT |
Ga0210403_109076892 | 3300020580 | Soil | MPPMIPAPGAFLAGIAIFLIVVWDAFESIILPRRVTRKF |
Ga0210404_100389561 | 3300021088 | Soil | MPHMLSAPGAFAVGVAIFLIVLWDAFEAIILPRRV |
Ga0210406_100033921 | 3300021168 | Soil | MILAPGVFIAGVIIFLIVSWDAFEAIILPRRVTRK |
Ga0210406_108319591 | 3300021168 | Soil | MPHMIPAPGAFIAGVAIFAIVLWDAFEAIILPRRVTRRFR |
Ga0210406_112609662 | 3300021168 | Soil | MPSVLPAPGAFVAGAALFSIVLWDAFEAIILPRRVTRKFR |
Ga0210408_112878081 | 3300021178 | Soil | MIPAPGAFAAGLAIFLIVIWDAFEAIILPRRVTRK |
Ga0210408_113328421 | 3300021178 | Soil | MILAPGVFIAGVVIFLIVLWDAFEAIILPRRVTRKFR |
Ga0210397_112877761 | 3300021403 | Soil | MQQLIPNPGAFVAGIVIFLVVVWDAFESIILPRRV |
Ga0210386_117508862 | 3300021406 | Soil | MQHVIPNPGAFVAGIAIFLIVVWDAFEAIILPRRVTR |
Ga0210383_110434851 | 3300021407 | Soil | MQHVIPVPGAFVAGILIFLIVVWDAFEAIILPRRVT |
Ga0210383_115915441 | 3300021407 | Soil | MNTVSHMIPEPGVFLLGVALFMFVIWDAFEAIILPRRVTRKFRF |
Ga0210394_115639591 | 3300021420 | Soil | MLAMIPVPGVFIAGVVLFFVVIWDAFEAIILPRRVTRK |
Ga0210384_106240471 | 3300021432 | Soil | MILAPGVFIAGLVIFFIVSWDAFEAIILPRRVTRKFRLA |
Ga0210384_112796862 | 3300021432 | Soil | MPHMIPLPVPFAAGVAIFMIVLWDAFESIILPRRVTRKF |
Ga0187846_103022741 | 3300021476 | Biofilm | MPHMIPAPGAFAAGVAIFAIVVWDAFEAIILPRRVTRR |
Ga0210398_105935433 | 3300021477 | Soil | MPHMIPAPAAFIAGVAIFVIVLWDAFEAIILPRRVT |
Ga0210402_107733503 | 3300021478 | Soil | MILAPGVFIAGVVIFFIVSWDAFEAIILPRRVTRKFRL |
Ga0210410_1000779411 | 3300021479 | Soil | MILAPGVFIAGILIFLIVSWDAFEAIILPRRVTRKIRLTRI |
Ga0210409_100544856 | 3300021559 | Soil | MPHMIPFPGAFVAGALIFLIVIWDAFEAIILPRRVTRKIRLT |
Ga0242655_101651472 | 3300022532 | Soil | MILAPGVFIAGVVIFLIVLWDAFEAIILPRRVTRKFRL |
Ga0242655_101719161 | 3300022532 | Soil | MPHMIQAPGAFIAGVAIFLIVLWDAFEAIILPRRVTRKFRF |
Ga0242662_102187822 | 3300022533 | Soil | MILAPGVFIAGVVIFLIVIWDAFEAIILPRRVTRKFR |
Ga0242662_102196732 | 3300022533 | Soil | MILAPGVFIAGILIFLTVTWDAFEAIILPRRVTRKVR |
Ga0242662_102676552 | 3300022533 | Soil | MHQMIPAPGAFLAGVAIFLIVLWDAFEAIILPRRVTRKFR |
Ga0242654_102416521 | 3300022726 | Soil | MILAPGVFIAGVAIFLIVSWDAFEAIILPRRVTRKFR |
Ga0137417_14279427 | 3300024330 | Vadose Zone Soil | MLTSPAAFLIGVAILIIVVWDAFEVIILPRRVTRVFG |
Ga0257158_10999032 | 3300026515 | Soil | MIPAPGAFIAGFAIFLIVLWDAFEAIILPRRVTRKF |
Ga0209161_101789641 | 3300026548 | Soil | MPHMIPFPVPFAAGVAIFMIVLWDAFESIILPRRVT |
Ga0207742_1143311 | 3300026800 | Tropical Forest Soil | MLRMIPAPGVFIAGVVTFLVVLWDAFEAIILPRRV |
Ga0207858_10044034 | 3300026909 | Tropical Forest Soil | MLRMIPTPGVFIAGVAIFLVVVWDAFEAIILPRRVT |
Ga0207858_10051711 | 3300026909 | Tropical Forest Soil | MIPVPGAFIAGVAVFLVVAWDAFEAIILPRRVTRKF |
Ga0209179_10986782 | 3300027512 | Vadose Zone Soil | MTSVIPYPGEFAAGVAVFLVVVWDAFEAIILPRRV |
Ga0209528_10234861 | 3300027610 | Forest Soil | MTSVIPYPGEFAAGVALFLIVVWDAFEAIILPRRVTRK |
Ga0209076_10329034 | 3300027643 | Vadose Zone Soil | MPHMIPAPGAFAAGVAIFVIVVWDAFEAIILPRRVTRKF |
Ga0209009_11984772 | 3300027667 | Forest Soil | MLAMIPVPGVFIVGVALFFVVIWDAFEAIILPRRVTRKF |
Ga0209588_10737641 | 3300027671 | Vadose Zone Soil | MTSAISAPGEFLAGVALFLIVVWDAFEAIILPRRVTRKFR |
Ga0209118_100309211 | 3300027674 | Forest Soil | MPHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKFR |
Ga0209118_11004522 | 3300027674 | Forest Soil | MILAPGVFIAGVVIFLIVSWDAFEAIILPRRVTRKFRLARIY |
Ga0209248_100451183 | 3300027729 | Bog Forest Soil | MNTVPHMIPEPGVFLLGVAMFMFVIWDAFEAIILPRRVTRKF |
Ga0209180_102028133 | 3300027846 | Vadose Zone Soil | MIPVPGVFAAGVAIFLIVLWDAFEAIILPRRVTRKF |
Ga0209180_102152631 | 3300027846 | Vadose Zone Soil | MPHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTR |
Ga0209701_101582623 | 3300027862 | Vadose Zone Soil | MPHMIPFLGAFAAGVALFLIVIWDAFEAIILPRRVTRR |
Ga0209590_100160061 | 3300027882 | Vadose Zone Soil | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKFR |
Ga0209488_112145582 | 3300027903 | Vadose Zone Soil | MTSVIPYPGEFAAGVAVFLVVVWDAFEAIILPRRVTRKFRLT |
Ga0209006_102510281 | 3300027908 | Forest Soil | MQHLIPAPGAFVAGIVIFLIVVWDAFESIILPRRVT |
Ga0311352_103814401 | 3300029944 | Palsa | MPHMIPVPGIFILGVVIFLIVVWDAFEAIILPRRVTRKF |
Ga0075405_112874481 | 3300030847 | Soil | MLRMIPAPGVFIAGVVIFLVVAWDAFEAIILPRRV |
Ga0073994_100712121 | 3300030991 | Soil | MTSVIPYPGEFAADVALFLIVVWDAFEAIILPRRVTRKFR |
Ga0302308_105097292 | 3300031027 | Palsa | MNTTPHIIPVPGVFILGVAVFWIVVWDAFEAIILPR |
Ga0307483_10214592 | 3300031590 | Hardwood Forest Soil | MIPAPGAFVAGVVVFLVVAWDSFEAIILPRRVTRKF |
Ga0306917_115459401 | 3300031719 | Soil | MIPVPGAFVAGVAVFLVVAWDAFEAIILPRRVTRK |
Ga0306918_114254262 | 3300031744 | Soil | MIPAPGAFIAGVVVFLVVAWDAFEAIILPRRVTRKFRLT |
Ga0307477_108513622 | 3300031753 | Hardwood Forest Soil | MATAIPYPGVFAVGVALFLIVVWDAFEAIILPRRVTR |
Ga0307475_108012403 | 3300031754 | Hardwood Forest Soil | MLSMPPAPGAFVAGAALFLIVLWDAFEAIILPRRV |
Ga0318546_106438621 | 3300031771 | Soil | MLRMIPVPGIFIAGVAVFLVVVWDAFESVILPRRVTRRFR |
Ga0318529_101474951 | 3300031792 | Soil | MIPAPGAFIAGVVVFLVVAWDAFEAIILPRRVTRKF |
Ga0318511_103616141 | 3300031845 | Soil | MPHMIPAPGTFAAGAGLFLIVLWDAFESIILPRRVTRRF |
Ga0306919_110146602 | 3300031879 | Soil | MIPVPGAFVAGVAVFLVVAWDAFEAIILPRRVTRKFR |
Ga0306921_105189081 | 3300031912 | Soil | MLGMIPAPGVFLCGVAIFLIVLWDAFEAIILPRRVTRRF |
Ga0310912_107235013 | 3300031941 | Soil | MLTSPAAFFLGVAILVVVVWDAFEVIILPRRVTRRF |
Ga0310916_111653071 | 3300031942 | Soil | MIPAPGAFIAGLVVFLVVAWDAFEAIILPRRVTRRF |
Ga0306922_108970993 | 3300032001 | Soil | MILAPGVFVAGIAIFLFVIWDAFEAIILPRRVTRKFRLARF |
Ga0318570_104866821 | 3300032054 | Soil | MPHMIPAPGTFAAGVAVFLIVLWDAFESIILPRRVTRRF |
Ga0306924_120502181 | 3300032076 | Soil | MIPVPGVFLCGVVLFLVVLWDAFEAIILPRRVTRKF |
Ga0335070_105657341 | 3300032829 | Soil | MLRMIPVPGVFLAGIAVFLVVAWDAFEAIILPRRVTRR |
Ga0335081_125938941 | 3300032892 | Soil | MILRPGVFLAGVAIFYLVAWDAFEAIILPRRVTRKIR |
Ga0335077_107863601 | 3300033158 | Soil | MHGMIPHPLVFAAGFAIFVIVLWDAFESIILPRRVTR |
Ga0310914_118088131 | 3300033289 | Soil | MIPVPGAFVAGVAVFLVVAWDAFEAIILPRRVTRKFRL |
⦗Top⦘ |