| Basic Information | |
|---|---|
| Family ID | F101774 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PDCPRTLDLLERSIHVDVSPLCDEQDLDEIAFAFEKVAKQVLA |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 95.10 % |
| % of genes from short scaffolds (< 2000 bps) | 90.20 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.725 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.176 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01408 | GFO_IDH_MocA | 87.25 |
| PF02894 | GFO_IDH_MocA_C | 2.94 |
| PF01041 | DegT_DnrJ_EryC1 | 1.96 |
| PF02633 | Creatininase | 0.98 |
| PF00291 | PALP | 0.98 |
| PF07978 | NIPSNAP | 0.98 |
| PF13343 | SBP_bac_6 | 0.98 |
| PF16657 | Malt_amylase_C | 0.98 |
| PF00528 | BPD_transp_1 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 2.94 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.96 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.96 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.96 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.96 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.96 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_10873534 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300000956|JGI10216J12902_103853434 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300001305|C688J14111_10232414 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300004019|Ga0055439_10001793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4242 | Open in IMG/M |
| 3300004479|Ga0062595_100216803 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300005161|Ga0066807_1039387 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005178|Ga0066688_10885844 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005187|Ga0066675_10640541 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005335|Ga0070666_11115644 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005337|Ga0070682_100003808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. 49Tsu3.1M3 | 8384 | Open in IMG/M |
| 3300005435|Ga0070714_101675063 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300005447|Ga0066689_10814451 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005468|Ga0070707_100397684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1338 | Open in IMG/M |
| 3300005539|Ga0068853_100964991 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005540|Ga0066697_10610968 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005543|Ga0070672_100493656 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300005556|Ga0066707_10924907 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005561|Ga0066699_11273286 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005578|Ga0068854_100688985 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005764|Ga0066903_100962345 | All Organisms → cellular organisms → Bacteria | 1555 | Open in IMG/M |
| 3300006058|Ga0075432_10369539 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300006173|Ga0070716_100058445 | All Organisms → cellular organisms → Bacteria | 2219 | Open in IMG/M |
| 3300006575|Ga0074053_11891562 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006581|Ga0074048_12680859 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300006794|Ga0066658_10218963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1012 | Open in IMG/M |
| 3300006854|Ga0075425_101798468 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300009012|Ga0066710_100540888 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
| 3300009094|Ga0111539_11130654 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300009137|Ga0066709_102486779 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300009147|Ga0114129_13237457 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009156|Ga0111538_11841253 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300009176|Ga0105242_11808016 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300009545|Ga0105237_10228249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1862 | Open in IMG/M |
| 3300009545|Ga0105237_11776216 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009545|Ga0105237_12482701 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300009553|Ga0105249_10026795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ok909 | 5198 | Open in IMG/M |
| 3300010301|Ga0134070_10290560 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300010303|Ga0134082_10386040 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010366|Ga0126379_12230526 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010373|Ga0134128_11512400 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010375|Ga0105239_10407498 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300010375|Ga0105239_10951885 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300010396|Ga0134126_11547622 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010398|Ga0126383_12375195 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012011|Ga0120152_1066974 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300012198|Ga0137364_10247266 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300012198|Ga0137364_11298396 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012206|Ga0137380_11513589 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012208|Ga0137376_11755381 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012210|Ga0137378_11093138 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300012211|Ga0137377_10288061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1576 | Open in IMG/M |
| 3300012355|Ga0137369_10075852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2832 | Open in IMG/M |
| 3300012359|Ga0137385_11461470 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012361|Ga0137360_11470308 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012582|Ga0137358_11077030 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012927|Ga0137416_10912071 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012930|Ga0137407_11954439 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012951|Ga0164300_10401992 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300012955|Ga0164298_10047033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2050 | Open in IMG/M |
| 3300012957|Ga0164303_10169381 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300012958|Ga0164299_10219041 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300012971|Ga0126369_10970752 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300012989|Ga0164305_11983581 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300014745|Ga0157377_10015713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 3879 | Open in IMG/M |
| 3300014829|Ga0120104_1046947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 809 | Open in IMG/M |
| 3300014969|Ga0157376_12086957 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300015054|Ga0137420_1479522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6978 | Open in IMG/M |
| 3300015265|Ga0182005_1113636 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300015374|Ga0132255_105260073 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300016404|Ga0182037_11913023 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300018029|Ga0187787_10450940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300018433|Ga0066667_11444730 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300019866|Ga0193756_1044151 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300025538|Ga0210132_1002276 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300025908|Ga0207643_10838207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300025913|Ga0207695_10678565 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300025917|Ga0207660_10190783 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300025932|Ga0207690_10073772 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
| 3300025937|Ga0207669_11146010 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300025960|Ga0207651_11445461 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300026041|Ga0207639_11180450 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300026041|Ga0207639_11985846 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027882|Ga0209590_10259529 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300028674|Ga0302161_10210176 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300028715|Ga0307313_10213323 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300028743|Ga0302262_10269144 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300028755|Ga0307316_10115919 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300028787|Ga0307323_10327054 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300028819|Ga0307296_10606020 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300028878|Ga0307278_10458690 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300030336|Ga0247826_11388826 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031460|Ga0272430_1178057 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031740|Ga0307468_100688013 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300031996|Ga0308176_12967229 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300032001|Ga0306922_11203776 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300032010|Ga0318569_10469552 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300032173|Ga0315268_11571019 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300032261|Ga0306920_103860167 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300032397|Ga0315287_12570552 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300032401|Ga0315275_12507697 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032828|Ga0335080_11727363 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300032893|Ga0335069_11846823 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.82% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.94% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.96% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028674 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031460 | Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nord | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_108735341 | 3300000891 | Soil | LERSIHVDVSPLCEEQDLDEIGFAFEKVAKQVLA* |
| JGI10216J12902_1038534341 | 3300000956 | Soil | LERSIHVDLSPCNDEQDLDQIGFAFEKVAHGVLEPG* |
| C688J14111_102324141 | 3300001305 | Soil | PAPECPRTLALLARSIHVDVSPLCDEHDLDEIAFAFEKVARVILA* |
| Ga0055439_100017937 | 3300004019 | Natural And Restored Wetlands | AEAGLPAPDCPRTLDLTSRAIHVDVSPLNEAQDLQEIALAFTKVASSVLS* |
| Ga0062595_1002168031 | 3300004479 | Soil | TQPDCPRTLELLERSIHVDVSPLCDEQDIDEIAFAFEKVAKQVLA* |
| Ga0066807_10393872 | 3300005161 | Soil | DCPRTLDLLERAVHLDVSPLDDGEDLTEIELALTKVATQVLG* |
| Ga0066688_108858441 | 3300005178 | Soil | PRPECPHTLDLLERAVHIDVSPLCDEQDLDEIALAFRKVATRVLA* |
| Ga0066675_106405412 | 3300005187 | Soil | CPRTLALLERSVHIDVSPLCDEQDLDEIAFSFEKVARVILA* |
| Ga0070666_111156442 | 3300005335 | Switchgrass Rhizosphere | SGGTAPECPRTLELVERSIHIDVSPLCEEQDLDEIAFAFEKVAKQVLA* |
| Ga0070682_1000038081 | 3300005337 | Corn Rhizosphere | PRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA* |
| Ga0070714_1016750631 | 3300005435 | Agricultural Soil | PDCPQTLGLLERTIHVDLSPLLDEQDVDEIALAFEKVARGILA* |
| Ga0066689_108144512 | 3300005447 | Soil | AGAPLPDCPRTLDLLERTIHVDVSPLCEEQDLEEIALAFRKVATRVLA* |
| Ga0070707_1003976841 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RTLALLERAIHVDVSSLCDEQDLDEIAFAFAKVAHGILEPA* |
| Ga0068853_1009649912 | 3300005539 | Corn Rhizosphere | PRTLDLLERSIHVDLSPLLDEQDIDELALAFEKVARGILA* |
| Ga0066697_106109682 | 3300005540 | Soil | ECPRTLDLLERAIHVDVSPLCDEHDLDEIALAFRKVSSQILA* |
| Ga0070672_1004936562 | 3300005543 | Miscanthus Rhizosphere | PDCPRTLDLVERAIHVDVSPLCEERDLDEIAFAFEKVAKQVLA* |
| Ga0066707_109249071 | 3300005556 | Soil | APDCPRTLELLERSIHVDVSPLCDEQDLEEIAFAFEKVAKQVLA* |
| Ga0066699_112732862 | 3300005561 | Soil | TLDLLGRAIHVDVSPLLEEQDLEEIALAFRKVANAILA* |
| Ga0068854_1006889851 | 3300005578 | Corn Rhizosphere | LERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA* |
| Ga0066903_1009623453 | 3300005764 | Tropical Forest Soil | CPRTLELLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVLESS* |
| Ga0075432_103695392 | 3300006058 | Populus Rhizosphere | SGRPQPDCPRTLALLERSIHVDLSPLNDEQDLEEIGFAFEKVAHAVLGAA* |
| Ga0070716_1000584451 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SGGAAPECPRTLELLERSIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA* |
| Ga0074053_118915622 | 3300006575 | Soil | RTLELLERSIHIDVSPLCEEQDLDEIAFAFEKVAKQVLA* |
| Ga0074048_126808592 | 3300006581 | Soil | GNPAPDCPRTLELTGRAIHVDLSPLCDEQDLDEIALAFEKVAHAVLA* |
| Ga0066658_102189631 | 3300006794 | Soil | DLLERAVHIDVSPLCDEQDLDEIALAFRKVATRVLA* |
| Ga0075425_1017984681 | 3300006854 | Populus Rhizosphere | DCPRTLALLERSIHVDLSPLNDEQDLEEIGFAFEKVAHAVLGAA* |
| Ga0066710_1005408881 | 3300009012 | Grasslands Soil | AAGRPAPDCPRTLDLLERAIHVDVSPLCVGQDLEEIALAFRKVSDQVLS |
| Ga0111539_111306542 | 3300009094 | Populus Rhizosphere | PRTLGLLERSIHVDLSPLNDEHDLDEIGFAFEKVAHGVLEPG* |
| Ga0066709_1024867791 | 3300009137 | Grasslands Soil | LLERSIHIDVSPLCDEQDLDEIAFAFEKVARVILA* |
| Ga0114129_132374571 | 3300009147 | Populus Rhizosphere | PDCPRTLDLLERSIHVDVSPLCDEQDLDEIAFAFEKVAKQVLA* |
| Ga0111538_118412531 | 3300009156 | Populus Rhizosphere | LGTQPDCPRTLELLERSIHVDVSPLCDEQDIDEIAFAFEKVAKQVLA* |
| Ga0105242_118080162 | 3300009176 | Miscanthus Rhizosphere | ALWAADADAPDCPRTLELRERSIHVDVSPLCEEQDLEEIAFAFEKVAKQVLT* |
| Ga0105237_102282491 | 3300009545 | Corn Rhizosphere | CPRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA* |
| Ga0105237_117762161 | 3300009545 | Corn Rhizosphere | AAGRPSPHCPQTLALVERAIHVDLSPLCDEQDLDEIAFAFEKVARGILA* |
| Ga0105237_124827012 | 3300009545 | Corn Rhizosphere | TLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA* |
| Ga0105249_100267951 | 3300009553 | Switchgrass Rhizosphere | RTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA* |
| Ga0134070_102905602 | 3300010301 | Grasslands Soil | LLERSIHIDVSPLCEERDLDEIAFAFEKVAKQVLA* |
| Ga0134082_103860401 | 3300010303 | Grasslands Soil | LDLLERAVHIDVSPLCDEQDLDEIALAFRKVATRVLA* |
| Ga0126379_122305262 | 3300010366 | Tropical Forest Soil | ELLERTIHVDLPPLNDEQDLDEIAFAFEKVADGVLGTA* |
| Ga0134128_115124001 | 3300010373 | Terrestrial Soil | ERPDCPRTLDLVERAIHVDVSPLCEERDLDEIAFAFEKVAKQVLV* |
| Ga0105239_104074981 | 3300010375 | Corn Rhizosphere | KGEPAPDCPRTLELLERTIHVDLSPLLEDADVDELALAFEKVARGILA* |
| Ga0105239_109518852 | 3300010375 | Corn Rhizosphere | PDCHRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA* |
| Ga0134126_115476222 | 3300010396 | Terrestrial Soil | CPRTLELLERSIHIDVSPLCEEQDLNEISFAFEKVAKQVLA* |
| Ga0126383_123751951 | 3300010398 | Tropical Forest Soil | EAAGAPAPDCPQTLALLERAIHVDVSPLCDERDLDEIALAWRKVATQVLV* |
| Ga0120152_10669741 | 3300012011 | Permafrost | PDCPRTLDLLARTIHVDLSPLNDEQDLDEIAFAFEKVARGVLGTEA* |
| Ga0137364_102472662 | 3300012198 | Vadose Zone Soil | IEADGRPAPDCPRTVELLERTIHVDVSPLCEEQDLDEIAFAFEKVAKQVLV* |
| Ga0137364_112983961 | 3300012198 | Vadose Zone Soil | TLDLLERTVHIDVSPLCDAQDLDEIALAFRKVATQVLA* |
| Ga0137380_115135892 | 3300012206 | Vadose Zone Soil | LDLLERAVHIDVSPLCDQQDLDEIALAFRKVATRVLA* |
| Ga0137376_117553811 | 3300012208 | Vadose Zone Soil | TLELLERTIHIDLSPLCDEQDLDEIAFAFEKVANAILA* |
| Ga0137378_110931381 | 3300012210 | Vadose Zone Soil | AAGADRPDCPRTLELLERTIHVDVSPLCEDQDLHEIAFAFEKVAKQVLA* |
| Ga0137377_102880613 | 3300012211 | Vadose Zone Soil | DCPRTLELLERTIHVDVSPLCSEQDLDEIAFAFEKVAKQVLA* |
| Ga0137369_100758525 | 3300012355 | Vadose Zone Soil | AAGTPAPDCPRTLELLARTVHVDVAPQLDEQDLDEICLALTKVATQVLG* |
| Ga0137385_114614702 | 3300012359 | Vadose Zone Soil | GAARPDCPRTLELLERTIHVDVSPLCEEQDLEEIAFAFEKVAKQVLA* |
| Ga0137360_114703082 | 3300012361 | Vadose Zone Soil | RPDCPRTLDLLERAVHIDVSPLCDQQDLDEIALAFRKVATRVLA* |
| Ga0137358_110770302 | 3300012582 | Vadose Zone Soil | QPPPDCPRTLALLERSIHVDLSPLNDEQDLNEIAFAFEKVAHGVLEAA* |
| Ga0137416_109120712 | 3300012927 | Vadose Zone Soil | DCPRTLELLERTIHVDVSPLCDEQDLDEIAFAFEKVAKQVLA* |
| Ga0137407_119544392 | 3300012930 | Vadose Zone Soil | DCPRTLELLERTIHVDVSPLCEEQDLHEIAFAFEKVVKQVLA* |
| Ga0164300_104019922 | 3300012951 | Soil | LLERSIHVDVSPLCEEQDLDEIAFAFEKVAKQVLT* |
| Ga0164298_100470332 | 3300012955 | Soil | LLERSIHVDVSPLCEEQDLDETAFAFEKVAKQVLT* |
| Ga0164303_101693812 | 3300012957 | Soil | LLERSIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA* |
| Ga0164299_102190412 | 3300012958 | Soil | ASGGAAPECPRTLELLERSIHIDVSPLCEEQDLDEIAFAFEKVAKQVLA* |
| Ga0126369_109707521 | 3300012971 | Tropical Forest Soil | PDCPQTLGLLERSIHIDVSPLCDEHDLGEIAFAFEKVARVILA* |
| Ga0164305_119835811 | 3300012989 | Soil | PGPDCPRTLELLERSIHVDISPLCDDQDLDEIAFAFEKVAKRVLA* |
| Ga0157377_100157131 | 3300014745 | Miscanthus Rhizosphere | RPDCPRTLDLVERAIHVDVSPLCEERDLDEIAFAFEKVAKQVLA* |
| Ga0120104_10469471 | 3300014829 | Permafrost | LDLLERAIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA* |
| Ga0157376_120869572 | 3300014969 | Miscanthus Rhizosphere | PPDCPRTLALLERSIHVDVSPLCDETDLDEIALAFEKVAHGILAG* |
| Ga0137420_14795228 | 3300015054 | Vadose Zone Soil | MAAGADRPDCPRTLELLERTIHVDASPLCDEQDLDEIAFAFEKVAKQVLA* |
| Ga0182005_11136361 | 3300015265 | Rhizosphere | LLERTIHVDLSPLLEEADVDEVALAFEKVARGILA* |
| Ga0132255_1052600732 | 3300015374 | Arabidopsis Rhizosphere | DCPRTLALLERSIHVDLSPCNDEQDLDEIGFAYEKVAHGVLEPG* |
| Ga0182037_119130231 | 3300016404 | Soil | ELLERTIHVDLSPLNDEQDLDEIAFAFEKVAAGVL |
| Ga0187787_104509402 | 3300018029 | Tropical Peatland | AGRSAPDCPRTLDLLERSIHVDLSPLNDEQDLDEIAFAFEKVASGVLRAA |
| Ga0066667_114447302 | 3300018433 | Grasslands Soil | CPRTLALLERSVHIDVSPLCDEQDLDEIAFAFEKVARVILA |
| Ga0193756_10441512 | 3300019866 | Soil | PECPRTLGLLERSIHIDVSPLCEEQDLDEIAFAFEKVAKQVLA |
| Ga0210132_10022763 | 3300025538 | Natural And Restored Wetlands | IAEAGLPAPDCPRTLDLTSRAIHVDVSPLNEAQDLQEIALAFTKVASSVLS |
| Ga0207643_108382071 | 3300025908 | Miscanthus Rhizosphere | LDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA |
| Ga0207695_106785652 | 3300025913 | Corn Rhizosphere | LELLERTIHVDLSPLLEDADVDELALAFEKVARGILA |
| Ga0207660_101907833 | 3300025917 | Corn Rhizosphere | PRTLDLLERTIHVDLSPLLEEDDVDELALAFEKVARGILA |
| Ga0207690_100737721 | 3300025932 | Corn Rhizosphere | KAKGEPAPDCPRTLELLERTIHVDLSPLLEDADVDELALAFEKVARGILA |
| Ga0207669_111460101 | 3300025937 | Miscanthus Rhizosphere | GTAPECPRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA |
| Ga0207651_114454612 | 3300025960 | Switchgrass Rhizosphere | DADAPDCPRTLELLERSIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA |
| Ga0207639_111804501 | 3300026041 | Corn Rhizosphere | ECPRTLDLLERSIHIDVSPLCEDQDLGEIAFAFEKVAKQVLA |
| Ga0207639_119858462 | 3300026041 | Corn Rhizosphere | DAVGADAPDCPRTLDLLERSIHVDLSPLLDEQDIDELALAFEKVARGILA |
| Ga0209590_102595292 | 3300027882 | Vadose Zone Soil | EAGHPSPDCPRTLGLLERTIHVDVSPLCDEQDIDEIGFAFEKVAQGILGRT |
| Ga0302161_102101761 | 3300028674 | Fen | AGNPAPNCPRTLDLVGRAIHIDLSPLCDEQDLQELALAFTKVATAVLA |
| Ga0307313_102133231 | 3300028715 | Soil | DCPRTLDLVERAIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA |
| Ga0302262_102691442 | 3300028743 | Fen | LDLVGRAIHIDLSPLCDEQDLQELALAFTKVATAVLA |
| Ga0307316_101159192 | 3300028755 | Soil | ELLERSIHVDVSPLCEEQDLNEIAFAFEKVAKQVFA |
| Ga0307323_103270541 | 3300028787 | Soil | QPDCPRTLELLARAIHIDLSPLCDEQDLEEIAFAFEKVANGILA |
| Ga0307296_106060202 | 3300028819 | Soil | EADGRPAPDCPHTLELLERSIHIDVSPLCEERDLEEIAFAFEKVAKQVLA |
| Ga0307278_104586901 | 3300028878 | Soil | PPDCPRTLDLVERAIHVDVSPLCEEQDLDEIAFAFEKVAKQVLA |
| Ga0247826_113888262 | 3300030336 | Soil | LALLQRTIHVDLSPLNDEQDLDELGLAFEKVAHGVLEPA |
| Ga0272430_11780572 | 3300031460 | Rock | TLDLLGRAAHIDVSPLLTDQDVQETILAIHKVAEAIL |
| Ga0307468_1006880132 | 3300031740 | Hardwood Forest Soil | PRTLDLLERSIHVDISPLCDEQDLGEIAFAFEKVAKQVLA |
| Ga0308176_129672292 | 3300031996 | Soil | AYLKDRGAPAPDCPRTLGLLERTIHVDLSPLLEEADVDELALAFEKVARGILA |
| Ga0306922_112037762 | 3300032001 | Soil | RTLDLLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVLEVA |
| Ga0318569_104695521 | 3300032010 | Soil | APDCPRTLDLLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVL |
| Ga0315268_115710192 | 3300032173 | Sediment | GNPAPECPRTLALLSRTIHVDLSPLCDEQDLDEIALAFEKVARAVLA |
| Ga0306920_1038601671 | 3300032261 | Soil | RPAPECPRTLDLLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVLEVA |
| Ga0315287_125705521 | 3300032397 | Sediment | IDASGHDAPNRPRTLGLLERSIHVDVSPLCDDDDIDEIAFAFEKVAAAVVS |
| Ga0315275_125076972 | 3300032401 | Sediment | RPRTLDLLERSIHVDVSPLSDDDDIDEIAFAFEKVAAAVVS |
| Ga0335080_117273632 | 3300032828 | Soil | RTLELLERSIHVDLSPLNDEQDLDEIAFAFEKVAAGVLEAA |
| Ga0335069_118468231 | 3300032893 | Soil | LERSIHIDLSPLNDEQDLDEIAFAFEKVAAGVLEVAA |
| ⦗Top⦘ |