NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F101763

Metagenome Family F101763

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101763
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 44 residues
Representative Sequence GEEGTGWIDHWAITLGKPPQGAPVFPQWVIDRSKALGQPQP
Number of Associated Samples 92
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.02 %
% of genes from short scaffolds (< 2000 bps) 88.24 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.235 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(17.647 % of family members)
Environment Ontology (ENVO) Unclassified
(41.176 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.020 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.64%    β-sheet: 0.00%    Coil/Unstructured: 75.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01654Cyt_bd_oxida_I 12.75
PF00759Glyco_hydro_9 3.92
PF00578AhpC-TSA 3.92
PF01182Glucosamine_iso 3.92
PF08450SGL 2.94
PF00754F5_F8_type_C 2.94
PF13905Thioredoxin_8 2.94
PF02113Peptidase_S13 2.94
PF07244POTRA 2.94
PF07593UnbV_ASPIC 2.94
PF04185Phosphoesterase 2.94
PF13360PQQ_2 1.96
PF07883Cupin_2 1.96
PF03737RraA-like 1.96
PF02322Cyt_bd_oxida_II 0.98
PF064393keto-disac_hyd 0.98
PF03450CO_deh_flav_C 0.98
PF02367TsaE 0.98
PF13378MR_MLE_C 0.98
PF01988VIT1 0.98
PF00069Pkinase 0.98
PF00480ROK 0.98
PF13414TPR_11 0.98
PF04203Sortase 0.98
PF01842ACT 0.98
PF03853YjeF_N 0.98
PF00535Glycos_transf_2 0.98
PF01522Polysacc_deac_1 0.98
PF01041DegT_DnrJ_EryC1 0.98
PF13349DUF4097 0.98
PF13474SnoaL_3 0.98
PF07221GlcNAc_2-epim 0.98
PF13432TPR_16 0.98
PF00860Xan_ur_permease 0.98
PF01144CoA_trans 0.98
PF00072Response_reg 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1271Cytochrome bd-type quinol oxidase, subunit 1Energy production and conversion [C] 12.75
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 3.92
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.92
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 2.94
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 2.94
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 2.94
COG2027D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 2.94
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 1.96
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.96
COG4670Acyl CoA:acetate/3-ketoacid CoA transferaseLipid transport and metabolism [I] 0.98
COG0062NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domainNucleotide transport and metabolism [F] 0.98
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 0.98
COG2942Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase familyCarbohydrate transport and metabolism [G] 0.98
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.98
COG2057Acyl-CoA:acetate/3-ketoacid CoA transferase, beta subunitLipid transport and metabolism [I] 0.98
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.98
COG1788Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunitLipid transport and metabolism [I] 0.98
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.98
COG1294Cytochrome bd-type quinol oxidase, subunit 2Energy production and conversion [C] 0.98
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.98
COG0802tRNA A37 threonylcarbamoyladenosine biosynthesis protein TsaETranslation, ribosomal structure and biogenesis [J] 0.98
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.98
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.98
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.98
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.98
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.24 %
UnclassifiedrootN/A11.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_101223842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1010Open in IMG/M
3300001990|JGI24737J22298_10043952All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300002560|JGI25383J37093_10157399All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300004152|Ga0062386_100560324All Organisms → cellular organisms → Bacteria → Acidobacteria932Open in IMG/M
3300004479|Ga0062595_100589820All Organisms → cellular organisms → Bacteria → Acidobacteria862Open in IMG/M
3300005167|Ga0066672_10009849All Organisms → cellular organisms → Bacteria4542Open in IMG/M
3300005184|Ga0066671_10005604All Organisms → cellular organisms → Bacteria4597Open in IMG/M
3300005327|Ga0070658_10042290All Organisms → cellular organisms → Bacteria3680Open in IMG/M
3300005437|Ga0070710_10097379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1746Open in IMG/M
3300005445|Ga0070708_100370924All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1349Open in IMG/M
3300005445|Ga0070708_101522537All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300005518|Ga0070699_100166107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1955Open in IMG/M
3300005518|Ga0070699_101257325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae679Open in IMG/M
3300005530|Ga0070679_100313175All Organisms → cellular organisms → Bacteria → Acidobacteria1519Open in IMG/M
3300005557|Ga0066704_10630539All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300005842|Ga0068858_100120498All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.2453Open in IMG/M
3300005995|Ga0066790_10218861All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300006028|Ga0070717_10500005Not Available1099Open in IMG/M
3300006102|Ga0075015_100840839All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300006162|Ga0075030_100147666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1904Open in IMG/M
3300006173|Ga0070716_100214277Not Available1289Open in IMG/M
3300006358|Ga0068871_101751294All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300006791|Ga0066653_10525225All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300006796|Ga0066665_11030250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria629Open in IMG/M
3300006797|Ga0066659_11909232All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006854|Ga0075425_100725031All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300009012|Ga0066710_101539744All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1023Open in IMG/M
3300009088|Ga0099830_10916642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300009088|Ga0099830_11198994All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300009098|Ga0105245_10175735All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium2042Open in IMG/M
3300009101|Ga0105247_10019234Not Available4099Open in IMG/M
3300009101|Ga0105247_11595156All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300009137|Ga0066709_100531938All Organisms → cellular organisms → Bacteria → Acidobacteria1661Open in IMG/M
3300009148|Ga0105243_12464757All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300009174|Ga0105241_11219845All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300009176|Ga0105242_10007584All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8353Open in IMG/M
3300009176|Ga0105242_11051386All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium825Open in IMG/M
3300009551|Ga0105238_10265030All Organisms → cellular organisms → Bacteria → Acidobacteria1698Open in IMG/M
3300009683|Ga0116224_10536140Not Available558Open in IMG/M
3300010048|Ga0126373_12374083All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300010335|Ga0134063_10276201All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium804Open in IMG/M
3300010336|Ga0134071_10166410All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1078Open in IMG/M
3300010343|Ga0074044_11147043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300010358|Ga0126370_10883579All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300010364|Ga0134066_10458838All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300010366|Ga0126379_12657239All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300010375|Ga0105239_12884213All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300010396|Ga0134126_12332375All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300010401|Ga0134121_11640908All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300011269|Ga0137392_10705839All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300011269|Ga0137392_10902332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300011270|Ga0137391_11577997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300012201|Ga0137365_10791187All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300012205|Ga0137362_11249302Not Available628Open in IMG/M
3300012208|Ga0137376_10040844All Organisms → cellular organisms → Bacteria3747Open in IMG/M
3300012351|Ga0137386_10539677All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium840Open in IMG/M
3300012357|Ga0137384_10666274All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300012357|Ga0137384_10983470All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300012361|Ga0137360_10719891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae857Open in IMG/M
3300012362|Ga0137361_11033604All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300012918|Ga0137396_10935660All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300012927|Ga0137416_10627525Not Available938Open in IMG/M
3300012929|Ga0137404_10615008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7978Open in IMG/M
3300014969|Ga0157376_10323595All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1467Open in IMG/M
3300015372|Ga0132256_100288312All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300017966|Ga0187776_10204707All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300018027|Ga0184605_10450863All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300018044|Ga0187890_10291601All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300018482|Ga0066669_11930986All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300019789|Ga0137408_1086206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1676Open in IMG/M
3300019879|Ga0193723_1028045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1705Open in IMG/M
3300020004|Ga0193755_1008471All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3352Open in IMG/M
3300020062|Ga0193724_1057963Not Available815Open in IMG/M
3300024246|Ga0247680_1040817All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300025321|Ga0207656_10531442All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300025910|Ga0207684_10961838All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300025914|Ga0207671_11320200All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300025921|Ga0207652_10162094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2005Open in IMG/M
3300025929|Ga0207664_11219370All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300025938|Ga0207704_11269021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300025972|Ga0207668_12161673All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300026095|Ga0207676_10387011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1303Open in IMG/M
3300026298|Ga0209236_1157212All Organisms → cellular organisms → Bacteria → Acidobacteria949Open in IMG/M
3300026335|Ga0209804_1327990All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300026538|Ga0209056_10361938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium940Open in IMG/M
3300026538|Ga0209056_10379243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium897Open in IMG/M
3300027050|Ga0209325_1017787Not Available824Open in IMG/M
3300027297|Ga0208241_1036894All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300027812|Ga0209656_10103792All Organisms → cellular organisms → Bacteria → Acidobacteria1489Open in IMG/M
3300027882|Ga0209590_10853588All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300028673|Ga0257175_1018200All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1142Open in IMG/M
3300028828|Ga0307312_10871821All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300031446|Ga0170820_11324080All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300031446|Ga0170820_12272148All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031573|Ga0310915_10027998All Organisms → cellular organisms → Bacteria3492Open in IMG/M
3300031797|Ga0318550_10540395All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300031820|Ga0307473_11479276All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300031823|Ga0307478_11495399Not Available559Open in IMG/M
3300032205|Ga0307472_100914935All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300032782|Ga0335082_10785589Not Available814Open in IMG/M
3300033158|Ga0335077_10812842Not Available951Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.98%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001990Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3Host-AssociatedOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300024246Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10122384223300000955SoilGWLEHWAITQGKPPQGAPIFPQWVIDRNRALPRTQP*
JGI24737J22298_1004395213300001990Corn RhizosphereTYVGEEGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP*
JGI25383J37093_1015739913300002560Grasslands SoilEEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP*
Ga0062386_10007968433300004152Bog Forest SoilDEYVGEEGTSWLDHWAITRGHPPQNAPVFPQWVIDRANALPKGQPELPLFQ*
Ga0062386_10056032423300004152Bog Forest SoilGWIEHWAITRGRPPLNAPEFPEWVKDRYKALPPQPREEAIF*
Ga0062595_10058982023300004479SoilGTNWIDHWAITRGLPPQNTPVFPQWVIDRSKALPRPPTQP*
Ga0066672_1000984913300005167SoilTYVGEEGRGWLDHWAISQGKPPQGGPVFPQWVMDRAQKLRRPQP*
Ga0066671_1000560413300005184SoilEGTGWLEHWAITLGKPPQGAPSVPQWLNDRWTALHPDKP*
Ga0070658_1004229013300005327Corn RhizosphereEGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP*
Ga0070710_1009737923300005437Corn, Switchgrass And Miscanthus RhizosphereYSLPDTYVGEEGTGWIDHWAITMGKPPQSGPEFPQWVLDLAKSLRQPQP*
Ga0070708_10037092413300005445Corn, Switchgrass And Miscanthus RhizosphereGEEGTGWIEHWAITQGKIPQGAPVFPQAVIEKWKALAPTQP*
Ga0070708_10152253713300005445Corn, Switchgrass And Miscanthus RhizosphereYIGEEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP*
Ga0070699_10016610733300005518Corn, Switchgrass And Miscanthus RhizosphereLPDTYVGEEGTGWLEHWAISQGKIPQGAPAFPQAVIEKWKALAPTQP*
Ga0070699_10125732513300005518Corn, Switchgrass And Miscanthus RhizosphereEGTGWLDHWAITQGKIPQGAPVFPQAVIEKWKALAPTQP*
Ga0070679_10031317523300005530Corn RhizosphereIGEEGTNWIDHWAITRGQPPRNTPTFPQWVIDRSRALPRAPSQP*
Ga0066704_1063053913300005557SoilEEGTSWIDHWAITRGHPPQNGPVFPQWVIDRSNALPQRPTQP*
Ga0068858_10012049813300005842Switchgrass RhizosphereGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP*
Ga0066790_1021886133300005995SoilGWIEHWAITRGQPPRGTPEFPAWVLELWKALPRRPTQP*
Ga0070717_1050000523300006028Corn, Switchgrass And Miscanthus RhizosphereGTGWLEQWAITQGKPPQGAPTFPQWVSDRAKSLHQPQP*
Ga0075015_10084083913300006102WatershedsLPDTYVGEEGTGWLEHWAITLGKPPQGAPAFPHWVIERSKVLHQPQP*
Ga0075030_10014766613300006162WatershedsPDTYVGEGGTGWVDHWAITMGKPPMGSPVFPQWVIDRSKALHQPQP*
Ga0070716_10021427713300006173Corn, Switchgrass And Miscanthus RhizosphereGEEGTGWLDHWAIAMGKPPQGAPAFPQWVIDRAKTLHQPQP*
Ga0068871_10175129423300006358Miscanthus RhizosphereDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP*
Ga0066653_1052522523300006791SoilDDYIGEEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP*
Ga0066665_1103025033300006796SoilPDMYVGEEGTGWFDHWAITMGKPPQGAPAFPQWVIDRSKALQLPQGIVPVAPPPQ*
Ga0066659_1190923223300006797SoilGEEGTGWIDHWAITRGRPPLNTPVFPQWVIDRSNALPHRPTQP*
Ga0075425_10072503113300006854Populus RhizosphereVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP*
Ga0066710_10153974423300009012Grasslands SoilALSDQAYGLPDTFIGEEGSGWLDHWAITLGKPPQGAPSVPQWVNERWKVLRSPQP
Ga0099830_1091664223300009088Vadose Zone SoilLPDTFVGEEGSGWIDHWAVTLGKPPQGAPVFPQWVIDRSKALHLPQP*
Ga0099830_1119899413300009088Vadose Zone SoilGTGWLDHWAITMGKPPQGSPRFPAWVDERYKVLPLPQQPQQPH*
Ga0105245_1017573533300009098Miscanthus RhizosphereDQAYGLPDTYVGEEGTGWLDHWAIALGKPPQGAPVFPQWVIDRSKVLHLPQP*
Ga0105247_1001923453300009101Switchgrass RhizosphereGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP*
Ga0105247_1159515613300009101Switchgrass RhizosphereGMPDSYVGEEGTGWIDHWAVTQGKPPQGMPIFPQWVIDRSRALHQPQP*
Ga0066709_10053193813300009137Grasslands SoilDTFIGEEGSGWLDHWAITLGKPPQGAPSVPQWVNERWKVLRTPQP*
Ga0105243_1246475723300009148Miscanthus RhizosphereAYGLPDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP*
Ga0105241_1121984513300009174Corn RhizosphereEEGTGWLDHWAVSLGKPPQNAPVFPQWVIERSKNLALPQP*
Ga0105242_1000758483300009176Miscanthus RhizosphereLPDTYVGEEGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP*
Ga0105242_1105138623300009176Miscanthus RhizosphereVGEEGTGWLDHWAIALGKPPQGAPVFPQWVIDRSKVLHLPQP*
Ga0105238_1026503013300009551Corn RhizosphereLNDSAYALPDTYVGEEGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP*
Ga0116224_1053614013300009683Peatlands SoilEEGAGWLDHWAITQGKPPQGAPVFPQWVIDRSKPLHQPQP*
Ga0126373_1237408323300010048Tropical Forest SoilWLDHWAITMGKPPQGEPVFPQWVIDLAKPLRQPQP*
Ga0134063_1027620133300010335Grasslands SoilDALSDQAYGLPDTFVGEEGTGWLDHWAIALGKPPQGSPTVPQWVNERWKVLRAPQP*
Ga0134071_1016641013300010336Grasslands SoilQAYGLPDTFIGEEGTGWLDHWAITLGKPPRGGAPSVPQWVNERWKVLRSPQP*
Ga0074044_1114704313300010343Bog Forest SoilDTFVAEEGTGWIDHWAITLGHPPQGAPVFPQWVMDRSKALHQPQP*
Ga0126370_1088357923300010358Tropical Forest SoilWLDHWAITMGKPPQGAPEFPKWVIDRAQSLHKPQP*
Ga0134066_1045883823300010364Grasslands SoilGEGGTGWLEHWAITQGKIPQGAPVFPQAVFEKWKALWATQP*
Ga0126379_1265723923300010366Tropical Forest SoilGWLDHWAITMGKPPQGEPVFPQWVIDLAKPLRQPQP*
Ga0105239_1288421313300010375Corn RhizosphereGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP*
Ga0134126_1233237523300010396Terrestrial SoilQAYGLPDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP*
Ga0134121_1164090813300010401Terrestrial SoilEEGTGWLDHWAITLGKPPQGAPVFPQWVIDRSKLLHLPQP*
Ga0137392_1070583923300011269Vadose Zone SoilEEGTGWLEHWAITMGKPPQGSPRFPAWVDERYKVLPLPQQPQQPH*
Ga0137392_1090233223300011269Vadose Zone SoilDEYVGEEGTNWLDHWAVTRGQPPQGVPEFPSDMLDKSKALARTPPLQ*
Ga0137391_1157799723300011270Vadose Zone SoilYSLPDEYVGEEGTNWLDHWAVTRGQPPQGVPEFPPDMLERSKALPRTPPLQ*
Ga0137365_1079118713300012201Vadose Zone SoilYIGEEGTAWIDHWAITRGRPPLNTPVFPQWVIDRSNALPHRPTQP*
Ga0137362_1124930223300012205Vadose Zone SoilVGEEGTGWLDHWAIAMGKPPQGAPVFPQWVIDRAKTLHQAQP*
Ga0137376_1004084453300012208Vadose Zone SoilAYGLPDTYVGEGTGWLDHWGITQGKPPQGAPVFPQWVIDRSHALGR*
Ga0137386_1053967713300012351Vadose Zone SoilDHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP*
Ga0137384_1066627413300012357Vadose Zone SoilHWAITRGRPPLNTPVFPQWVIDRSNALPHRPTQP*
Ga0137384_1098347023300012357Vadose Zone SoilGTGWMEHWAITQGKIPQGAPVFPQGVIEKWKALAPTQP*
Ga0137360_1071989113300012361Vadose Zone SoilGTGWIEHWAITQGKIPQGAPVFPQAVIEKWKALAPTQP*
Ga0137361_1103360423300012362Vadose Zone SoilEEGTGWIEHWAITQGKIPQGAPVFPQAVIEKWKALAPTQP*
Ga0137396_1093566013300012918Vadose Zone SoilEGTGWLDHWAITMGKPPQGSPRFPAWVDERCKVLPLPQQPQQPH*
Ga0137416_1062752513300012927Vadose Zone SoilLSDQAYGLPDTYVGEEGSGWLDHWAISLGKPPQGAPVFPQWVIDRSKALHLPQP*
Ga0137404_1061500813300012929Vadose Zone SoilLDHWAISLGKPPQGAPVFPQWVIDRSKALHLPQP*
Ga0157376_1032359523300014969Miscanthus RhizosphereGAGWLEHWAITQGKPPQGAPIFPQWVIDRNRALPRTQP*
Ga0132256_10028831213300015372Arabidopsis RhizosphereEEGTGWLDHWAIAQGKPPQGAPVFPQWVIDRARPLRQPQP*
Ga0187776_1020470713300017966Tropical PeatlandQEGTGWIDHWAVTMGKPPQGAPVFPQWVIDRSKPLHAPQP
Ga0184605_1045086313300018027Groundwater SedimentALGDEAYGLPDTYVGEGTGWLDHWGITQGKPPQGAPVFPQWVIDRSHALGR
Ga0187890_1029160123300018044PeatlandDEYVGEEGAGWLEHWAITRGRPPLNAPVFPQWVIDRDKALPHGPPEEPIF
Ga0066669_1193098613300018482Grasslands SoilLPDTFVGEGGRGWLDHWAITIGKPPQGAPVFPQWVIDRSKALSPPQMQVPQ
Ga0137408_108620613300019789Vadose Zone SoilSEKEEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKSLPPHPQP
Ga0193723_102804523300019879SoilEEGTGWLEHWAITMGKPPQGAPEFPQWVIDRAKPLHQPQP
Ga0193755_100847123300020004SoilYVGEEGTGWLEHWAITMGKPPQGAPEFPQWVIDRAKPLHQPQP
Ga0193724_105796313300020062SoilGEEGTGWIDHWAITLGKPPQGAPVFPQWVIDRSKALGQPQP
Ga0247680_104081723300024246SoilLPDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP
Ga0207656_1053144233300025321Corn RhizosphereGLPDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP
Ga0207684_1096183823300025910Corn, Switchgrass And Miscanthus RhizosphereWIDHWAITRGHPPQNTPVFPQWVIDRSNALRPQQTQP
Ga0207671_1132020013300025914Corn RhizospherePDTYVGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP
Ga0207652_1016209413300025921Corn RhizosphereGEEGSNWLDHWAITQGHPPINTPVFPQWVIDRSKALPHRPTQP
Ga0207664_1121937023300025929Agricultural SoilWIDHWAITRGHPPQNTPVFPQWVIDLSNALPHRPTQP
Ga0207704_1126902123300025938Miscanthus RhizosphereALPDTYVGEEGTGWLDHWAIAQGKPPRGAPVFPQWVIDRSKALKLPQP
Ga0207668_1216167323300025972Switchgrass RhizosphereGEEGTGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP
Ga0207676_1038701113300026095Switchgrass RhizosphereGWIDHWAVTQGKPPQGAPVFPQWVIDRSKVLHQPQP
Ga0209236_115721223300026298Grasslands SoilGWMEHWAITQGKIPQGAPVFPQGVIEKWKALAPTQP
Ga0209804_132799023300026335SoilPDDYIGEEGTGWLDHWAITRGQPPQNAPVFPQWVIDRSKALPPHPQP
Ga0209056_1036193813300026538SoilSDQAYGLPDTFIGEEGSGWLDHWAITLGKPPQGAPSVPQWVNERWKVLRTPQP
Ga0209056_1037924313300026538SoilTGWLDHWAITRGKPPQGAPEFPAWVIEKSRAIQKPPP
Ga0209325_101778713300027050Forest SoilYVGEEGTGWLDHWAIAMGKPPQGAPVFPQWVIDRAKVLHQPQP
Ga0208241_103689423300027297Forest SoilEEGSGWIEHWAIAQGHPPQGAPVFPQWVIDRSKALHQPQP
Ga0209656_1010379213300027812Bog Forest SoilGEEGTSWLDHWAITRGHPPQNAPVFPQWVIDRANALPKGQPELPLFQ
Ga0209590_1085358823300027882Vadose Zone SoilAYSLPDEYVGEEGTNWLDHWAVTRGQPPQGVPEFPSDMLDKSKALARTPPLQ
Ga0257175_101820013300028673SoilQAYSLPDTFVGEEGTGWIDHWAITLGKPPQGSPVFPQWVIDRSKALKLPQP
Ga0307312_1087182123300028828SoilGWIDHWAITLGKPPQGSPVFPQWVIDRSKALKLPQP
Ga0170820_1132408023300031446Forest SoilPDEYVGEEGTNWIDHWAITRGHPPQNTPVFPQWVIDRSNALHSSAAQPAY
Ga0170820_1227214813300031446Forest SoilWIDHWAITRGHPPQNTPVFPQWVIDRSNALRPPQTQP
Ga0310915_1002799813300031573SoilEEGTGWLDHWAITRGRPPQNTPVFPQWVIDRSKALPRPPPETPIF
Ga0318550_1054039523300031797SoilDEYVGEEGTGWLDHWAITRGRPPQNTPVFPQWVIDRSKALPRPPPETPIF
Ga0307473_1147927613300031820Hardwood Forest SoilGEEGTGWLDHWAITMGKPPQGAPEFPQWVIDRAKALHHPQP
Ga0307478_1149539913300031823Hardwood Forest SoilFVGEEGTGWLDHWAITMGKPPQGSPRFPTWVDERYKVLPLPQQPQQPH
Ga0307472_10091493523300032205Hardwood Forest SoilPDTFVGEEGTGWIDHWAISQGKPPLGVPVFPQWVIDRSKALHQPQPQAALP
Ga0335082_1078558913300032782SoilYIGEEGTDWLDHWAITRGKPPQGRPVFPQWVIERSKTIPRPPATVH
Ga0335077_1081284213300033158SoilSLPDTYVGEEGTGWLDHWAITMGKPPQGAPVFPQWVIDRAKPLRQPQP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.