Basic Information | |
---|---|
Family ID | F101742 |
Family Type | Metagenome |
Number of Sequences | 102 |
Average Sequence Length | 44 residues |
Representative Sequence | KLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Number of Associated Samples | 72 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.02 % |
% of genes from short scaffolds (< 2000 bps) | 79.41 % |
Associated GOLD sequencing projects | 63 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (85.294 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (50.980 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.059 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.941 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.40% β-sheet: 0.00% Coil/Unstructured: 72.60% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF07722 | Peptidase_C26 | 42.16 |
PF13561 | adh_short_C2 | 6.86 |
PF12704 | MacB_PCD | 6.86 |
PF00106 | adh_short | 2.94 |
PF01979 | Amidohydro_1 | 1.96 |
PF01402 | RHH_1 | 0.98 |
PF05168 | HEPN | 0.98 |
PF00731 | AIRC | 0.98 |
PF07963 | N_methyl | 0.98 |
PF12019 | GspH | 0.98 |
PF03681 | Obsolete Pfam Family | 0.98 |
PF01850 | PIN | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.98 |
COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 85.29 % |
Unclassified | root | N/A | 14.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002560|JGI25383J37093_10172735 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300002562|JGI25382J37095_10163721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
3300002907|JGI25613J43889_10193830 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300002914|JGI25617J43924_10089732 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300004080|Ga0062385_10175268 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300004080|Ga0062385_10629900 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300005174|Ga0066680_10085115 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
3300005178|Ga0066688_10326286 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300005446|Ga0066686_10061906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2318 | Open in IMG/M |
3300005553|Ga0066695_10367760 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300005557|Ga0066704_10056327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2496 | Open in IMG/M |
3300005559|Ga0066700_10025787 | All Organisms → cellular organisms → Bacteria | 3367 | Open in IMG/M |
3300006173|Ga0070716_100627893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
3300006794|Ga0066658_10013266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3082 | Open in IMG/M |
3300006796|Ga0066665_10194718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1569 | Open in IMG/M |
3300006804|Ga0079221_10177125 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300007255|Ga0099791_10309152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300007258|Ga0099793_10021577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2651 | Open in IMG/M |
3300009088|Ga0099830_10018685 | All Organisms → cellular organisms → Bacteria | 4465 | Open in IMG/M |
3300009088|Ga0099830_11115476 | Not Available | 654 | Open in IMG/M |
3300009089|Ga0099828_10243702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1611 | Open in IMG/M |
3300009089|Ga0099828_10630014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 965 | Open in IMG/M |
3300009089|Ga0099828_11648115 | Not Available | 564 | Open in IMG/M |
3300009089|Ga0099828_11924659 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300009090|Ga0099827_10609691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 941 | Open in IMG/M |
3300009090|Ga0099827_11853322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300010320|Ga0134109_10030059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1722 | Open in IMG/M |
3300010361|Ga0126378_10633304 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300011269|Ga0137392_10151315 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
3300011270|Ga0137391_10130848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2181 | Open in IMG/M |
3300011270|Ga0137391_10402059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
3300011270|Ga0137391_10698443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
3300012096|Ga0137389_10420907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
3300012096|Ga0137389_10936438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300012189|Ga0137388_11721758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300012203|Ga0137399_10679144 | Not Available | 867 | Open in IMG/M |
3300012203|Ga0137399_11239561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300012205|Ga0137362_10462761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1098 | Open in IMG/M |
3300012205|Ga0137362_11346458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300012210|Ga0137378_10367514 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300012211|Ga0137377_11922558 | Not Available | 509 | Open in IMG/M |
3300012362|Ga0137361_10180855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1900 | Open in IMG/M |
3300012363|Ga0137390_10500649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
3300012363|Ga0137390_11062504 | Not Available | 760 | Open in IMG/M |
3300012363|Ga0137390_11947389 | Not Available | 515 | Open in IMG/M |
3300012582|Ga0137358_10014405 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4990 | Open in IMG/M |
3300012582|Ga0137358_10023922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3955 | Open in IMG/M |
3300012582|Ga0137358_10158627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1542 | Open in IMG/M |
3300012582|Ga0137358_10935385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300012917|Ga0137395_11170053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
3300012918|Ga0137396_10051175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2833 | Open in IMG/M |
3300012924|Ga0137413_11836252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300012925|Ga0137419_10054298 | Not Available | 2598 | Open in IMG/M |
3300012925|Ga0137419_10471601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
3300012927|Ga0137416_10065920 | Not Available | 2606 | Open in IMG/M |
3300012971|Ga0126369_10375646 | Not Available | 1452 | Open in IMG/M |
3300015054|Ga0137420_1465879 | All Organisms → cellular organisms → Bacteria | 4144 | Open in IMG/M |
3300015241|Ga0137418_10232185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
3300016404|Ga0182037_11591829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300018006|Ga0187804_10046849 | Not Available | 1682 | Open in IMG/M |
3300020579|Ga0210407_10399423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
3300020579|Ga0210407_10523823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 926 | Open in IMG/M |
3300020580|Ga0210403_10956785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300020581|Ga0210399_10021822 | All Organisms → cellular organisms → Bacteria | 5075 | Open in IMG/M |
3300021170|Ga0210400_10176460 | Not Available | 1730 | Open in IMG/M |
3300021178|Ga0210408_10010534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7701 | Open in IMG/M |
3300021432|Ga0210384_10432977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1185 | Open in IMG/M |
3300021474|Ga0210390_10551691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
3300021478|Ga0210402_11469628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300024330|Ga0137417_1224134 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300025939|Ga0207665_11159435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300026301|Ga0209238_1069071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1245 | Open in IMG/M |
3300026330|Ga0209473_1020270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3115 | Open in IMG/M |
3300026497|Ga0257164_1053698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300026532|Ga0209160_1215226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300026548|Ga0209161_10119969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
3300026551|Ga0209648_10057751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3300 | Open in IMG/M |
3300026557|Ga0179587_11142775 | Not Available | 512 | Open in IMG/M |
3300027671|Ga0209588_1057034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1262 | Open in IMG/M |
3300027671|Ga0209588_1088358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
3300027826|Ga0209060_10306604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300027862|Ga0209701_10043235 | Not Available | 2906 | Open in IMG/M |
3300027862|Ga0209701_10163904 | Not Available | 1348 | Open in IMG/M |
3300027862|Ga0209701_10330535 | Not Available | 868 | Open in IMG/M |
3300027875|Ga0209283_10168436 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300027882|Ga0209590_10025993 | All Organisms → cellular organisms → Bacteria | 3027 | Open in IMG/M |
3300027903|Ga0209488_10019324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4944 | Open in IMG/M |
3300027903|Ga0209488_10122443 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
3300027903|Ga0209488_10446087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
3300027903|Ga0209488_10537878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
3300031561|Ga0318528_10090121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1599 | Open in IMG/M |
3300031718|Ga0307474_10585974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
3300031740|Ga0307468_101907181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300031823|Ga0307478_10634546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
3300031823|Ga0307478_10693091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
3300031962|Ga0307479_10024174 | All Organisms → cellular organisms → Bacteria | 5754 | Open in IMG/M |
3300031962|Ga0307479_12081408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300032180|Ga0307471_100446681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1431 | Open in IMG/M |
3300032180|Ga0307471_100707918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
3300032180|Ga0307471_101822988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
3300032180|Ga0307471_102767753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300032180|Ga0307471_104039605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 50.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.88% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25383J37093_101727352 | 3300002560 | Grasslands Soil | PRPSRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALTPSASLRA* |
JGI25382J37095_101637211 | 3300002562 | Grasslands Soil | SPRPGRKLGHITVRAASPERLALRLSELPAFFHRPDFCLDAALVHSASLRA* |
JGI25613J43889_101938301 | 3300002907 | Grasslands Soil | PRPGRKLGHLTLRAASPERLGLRLSELPAFFHRPDFCLEAALAPSASLRA* |
JGI25617J43924_100897322 | 3300002914 | Grasslands Soil | HLTLRAASPERLALRLSELPTFFHRPDFCLDAALAPSASLRA* |
Ga0062385_101752681 | 3300004080 | Bog Forest Soil | RAGRKLGHITLRAASTEQLALRLAELPGFFHRPEFCLDAVLARPLTSRA* |
Ga0062385_106299001 | 3300004080 | Bog Forest Soil | RAGRKLGHITLRAASAEQLASRLAELPGFFHRPEFCLDAVLARPLTSRA* |
Ga0066680_100851154 | 3300005174 | Soil | PGRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAHSASARL* |
Ga0066688_103262861 | 3300005178 | Soil | GRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0066686_100619064 | 3300005446 | Soil | LGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALTPSASLRA* |
Ga0066695_103677601 | 3300005553 | Soil | KSPRPGRKLGHVTLRAASPERLALRLSELPAFFRRPDFCLDVALAPSASLRA* |
Ga0066704_100563274 | 3300005557 | Soil | LGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALVHSASLRT* |
Ga0066700_100257875 | 3300005559 | Soil | TVRAASPERLALRLSELPTFFHRPDFCLDSALSQSASQRA* |
Ga0070716_1006278931 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LGHVTLRAGSAEQLASRLAELPGFFHRPEFCLDAVLARPAPLRA* |
Ga0066658_100132664 | 3300006794 | Soil | KLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALVHSASLRA* |
Ga0066665_101947181 | 3300006796 | Soil | RAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRD* |
Ga0079221_101771253 | 3300006804 | Agricultural Soil | GRKLGHVTLRAASPERLALRLSELPAFFHRPEFCLDSALVQSASQRV* |
Ga0099791_103091521 | 3300007255 | Vadose Zone Soil | LRAASPERLGLRLSELPAFFHQPDFCLEAALAPSASLRA* |
Ga0099793_100215776 | 3300007258 | Vadose Zone Soil | ERLALRLSELPAFFHRPDFCLDAALAPAPSASLRA* |
Ga0099830_100186855 | 3300009088 | Vadose Zone Soil | IALRGQIGEPPESSEVIALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0099830_111154762 | 3300009088 | Vadose Zone Soil | GRKLGHVTLRAASPERLALRLSEFPAFFHRPAPAFDDALAPSASLRA* |
Ga0099828_102437021 | 3300009089 | Vadose Zone Soil | PGRKLGHVTLRAASPERLALRLSELPAFFHRPDFRLDAALAPSASLRA* |
Ga0099828_106300142 | 3300009089 | Vadose Zone Soil | SPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0099828_116481152 | 3300009089 | Vadose Zone Soil | TLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRS* |
Ga0099828_119246591 | 3300009089 | Vadose Zone Soil | HLTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSAPLRA* |
Ga0099827_106096912 | 3300009090 | Vadose Zone Soil | AASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0099827_118533222 | 3300009090 | Vadose Zone Soil | PGRKLGHLTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSAPLRA* |
Ga0134109_100300593 | 3300010320 | Grasslands Soil | GHITVRAASPERLALRLSELPAFFHRPDFCLDAALVHSASLRA* |
Ga0126378_106333042 | 3300010361 | Tropical Forest Soil | PLPGRKLCHVTVRAASLERLALRLSELPAFFHRPDFCLDSALSQSASQRA* |
Ga0137392_101513151 | 3300011269 | Vadose Zone Soil | TLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0137391_101308484 | 3300011270 | Vadose Zone Soil | SVEQLASRLAELPVFFHRAEFCLEAGLGRAALRA* |
Ga0137391_104020592 | 3300011270 | Vadose Zone Soil | GHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0137391_106984432 | 3300011270 | Vadose Zone Soil | VTLRASSPGQLASRLGELSSFFQRADFCLDAALAAQPPLRA* |
Ga0137389_104209071 | 3300012096 | Vadose Zone Soil | RAGRKLGHVTLRASSPEQLASRLAELPTYFHRPEFGLDAVLRHATPARG* |
Ga0137389_109364381 | 3300012096 | Vadose Zone Soil | GRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALIPAPSASLRA* |
Ga0137388_117217582 | 3300012189 | Vadose Zone Soil | PRLGRKLGHVTLRAASPERLALRLSELSAFFHRPDFCLDAALAPSASLRA* |
Ga0137399_106791441 | 3300012203 | Vadose Zone Soil | PERLALRLSELPAFFHRPDFSLDSALALSASLRA* |
Ga0137399_112395612 | 3300012203 | Vadose Zone Soil | TLRAASPERLALRLSELPAFFHRPDFCLDAVLAPSAPLRA* |
Ga0137362_104627612 | 3300012205 | Vadose Zone Soil | RAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0137362_113464581 | 3300012205 | Vadose Zone Soil | PRPGRKLGHVTLRASSPEQLASRLGELPTYFHRPEFALDAALTRSVSSRA* |
Ga0137378_103675144 | 3300012210 | Vadose Zone Soil | SPERLALRLSELPAFFHRPDYCLDAALAPSASLRA* |
Ga0137377_119225582 | 3300012211 | Vadose Zone Soil | AASPERLALRLSELPAFFHRPDFCLDAALAPSASLRD* |
Ga0137361_101808551 | 3300012362 | Vadose Zone Soil | ASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0137390_105006491 | 3300012363 | Vadose Zone Soil | RKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0137390_110625041 | 3300012363 | Vadose Zone Soil | LGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSAPLRA* |
Ga0137390_119473891 | 3300012363 | Vadose Zone Soil | LRAASPEHLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0137358_100144051 | 3300012582 | Vadose Zone Soil | KLGHVTLRAASPERLALRLSELPAFFHRPDFCLDSALAHHASLRA* |
Ga0137358_100239226 | 3300012582 | Vadose Zone Soil | VTLRAASAEQLASRLAELPSFFHRPEFCLDAVLARPLSSRA* |
Ga0137358_101586271 | 3300012582 | Vadose Zone Soil | KLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0137358_109353852 | 3300012582 | Vadose Zone Soil | GRKLGHVTLRASSPEQLASRLGELPTYFHRPEFALDAALTRSVSSRA* |
Ga0137395_111700531 | 3300012917 | Vadose Zone Soil | PGRKLGHVTLRAASPERLGLRLSELPAFFHRPDFCLEAALAPSASLRA* |
Ga0137396_100511751 | 3300012918 | Vadose Zone Soil | PERLALRLSELPAFFHRPDFCLDAVLAPSAPLRA* |
Ga0137413_118362522 | 3300012924 | Vadose Zone Soil | GRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDSALAHHASLRA* |
Ga0137419_100542981 | 3300012925 | Vadose Zone Soil | RPGRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0137419_104716011 | 3300012925 | Vadose Zone Soil | ASPERLALRLSELPAFFHRPDFCLDAALTPSASLRA* |
Ga0137416_100659201 | 3300012927 | Vadose Zone Soil | SPRPGRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA* |
Ga0126369_103756461 | 3300012971 | Tropical Forest Soil | HVTLRAASPERLALRLSELPAFFHRPDFCLDSVLAQSASSRL* |
Ga0137420_14658795 | 3300015054 | Vadose Zone Soil | LGHVTLRAASPNAFALRLSELPAFFHRPDFCLDAALAPSASLPA* |
Ga0137418_102321851 | 3300015241 | Vadose Zone Soil | PERLALRLSELPAFFHHPDFCLDAALAPSASLRA* |
Ga0182037_115918291 | 3300016404 | Soil | KSPRSVLKLGHVTLRASSAEQLATRLGDLPSVFHRPEFCLEAAFARSASLRA |
Ga0187804_100468492 | 3300018006 | Freshwater Sediment | PGRKLGHITLRAASPERLALRLSELPAFFHGPEFCLDAALSHAASLPA |
Ga0210407_103994231 | 3300020579 | Soil | VTVRALSAEHLAARVSELPAFFHRPEYCLKAALGSAAPARA |
Ga0210407_105238232 | 3300020579 | Soil | SPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0210403_109567851 | 3300020580 | Soil | RKLGHVTLRASSPEQLASRLGELPTYFHRPEFALDAALDRSVSSRA |
Ga0210399_100218221 | 3300020581 | Soil | GHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0210400_101764601 | 3300021170 | Soil | GRKLGHVTLRASSPEQLASRLGELPSYFHRPEFSLEAVLRQSASARR |
Ga0210408_100105341 | 3300021178 | Soil | PGRKLGHLTLRAASPERLALRLSELPAFFHRPDFCLAAALTPSASFRA |
Ga0210384_104329773 | 3300021432 | Soil | KLGHVTLRAASAEQLASRLAELPSFFHRPEFCLDAIFARPLSSRA |
Ga0210390_105516912 | 3300021474 | Soil | LRAASPERLALRLSELPAFFHHPDFCLDAALAPSTPLRA |
Ga0210402_114696281 | 3300021478 | Soil | RAASPERLALRISELPSFFLRPEFCLNSALGHSTSHRA |
Ga0137417_12241343 | 3300024330 | Vadose Zone Soil | LRAASPELLALRLSELPAFLHRPGLCLDAALAPAASLPA |
Ga0207665_111594352 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AASSARVGRKLGHVTLRAGSAEQLASRLAELPGFFHRPEFCLDAVLARPAPLRA |
Ga0209238_10690713 | 3300026301 | Grasslands Soil | RKLGHITLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0209473_10202704 | 3300026330 | Soil | RKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALVHSASLRA |
Ga0257164_10536981 | 3300026497 | Soil | PRPGRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0209160_12152262 | 3300026532 | Soil | SPERLALRLSELPAFFHRPDFCLDAALTPSASLRA |
Ga0209161_101199691 | 3300026548 | Soil | PGRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALVHSASLRA |
Ga0209648_100577515 | 3300026551 | Grasslands Soil | VTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0179587_111427751 | 3300026557 | Vadose Zone Soil | LGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0209588_10570342 | 3300027671 | Vadose Zone Soil | TLRAASPERLAFRLSELPAFFHRPDFCLDSALALSASQRT |
Ga0209588_10883581 | 3300027671 | Vadose Zone Soil | ASPERLALRLSELPAFFHRPDFCLDSALAPSASLRA |
Ga0209060_103066042 | 3300027826 | Surface Soil | RAGRKLGHVTLRASSSEQLASRLSELSSFFHRPEYCLEAVLSRPASLRA |
Ga0209701_100432351 | 3300027862 | Vadose Zone Soil | ASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0209701_101639041 | 3300027862 | Vadose Zone Soil | EPPESSEVIALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0209701_103305351 | 3300027862 | Vadose Zone Soil | RKLGHVTLRAASPERLALRLSELPAFFHRHDFCLDAALAPSASLRS |
Ga0209283_101684361 | 3300027875 | Vadose Zone Soil | RKLGHLTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0209590_100259931 | 3300027882 | Vadose Zone Soil | RLGRKLGHVTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0209488_100193246 | 3300027903 | Vadose Zone Soil | RKLGHLTLRAASPERLALRLSELPAFFHRPDFCLDAALAPSAPLRA |
Ga0209488_101224431 | 3300027903 | Vadose Zone Soil | AGRKLGHVTLRAAAPEQLASRLGELPGFFHRPDFCLDAALSRAATPLRA |
Ga0209488_104460872 | 3300027903 | Vadose Zone Soil | RAGRKLGHVTLRAASPEQLASRLGELPGYFHRPEFGLDAVLGHSASARR |
Ga0209488_105378781 | 3300027903 | Vadose Zone Soil | SARAGRKLGHVTLRAASPEQLASRLGELPAYFHRPEFGLDAVLGHSASARR |
Ga0318528_100901211 | 3300031561 | Soil | KLGHVTVRAASPERLALRLSELPAFFHRPDFCLDSALSQSASQRA |
Ga0307474_105859742 | 3300031718 | Hardwood Forest Soil | LRAASAEQLASRLAELPGFFHRPEFCLDAALARPLSLRA |
Ga0307468_1019071811 | 3300031740 | Hardwood Forest Soil | GRKLGHVTLRAGSAEQLASRLAELPGFFHRPEFCLDAVLARPAPLRA |
Ga0307478_106345461 | 3300031823 | Hardwood Forest Soil | LRAASPERLALRLSELPAFFHRPDFCLDAALAPSAPLRA |
Ga0307478_106930911 | 3300031823 | Hardwood Forest Soil | LRAASPERLALRLSELPAFFHRPDFCLDAALAPSASLRA |
Ga0307479_100241741 | 3300031962 | Hardwood Forest Soil | TGRKLGHVSLRAASAEQLASRLAELSSFFHRPEFCLDAVLARPLSSRA |
Ga0307479_120814082 | 3300031962 | Hardwood Forest Soil | GRKLGHVTLRAASPEQLASRLGELPTYFHRPEFALDAALDRSVSSRA |
Ga0307471_1004466812 | 3300032180 | Hardwood Forest Soil | SPERLALRLSELPAFFHRPEFCLDAALTPSAPLRASS |
Ga0307471_1007079181 | 3300032180 | Hardwood Forest Soil | RKLGHVTLRAASPEQLASRLSELPSFFHRPDYCLDAALSRAASLRA |
Ga0307471_1018229881 | 3300032180 | Hardwood Forest Soil | VTLRAASPERLALRLSELPAFFHRPDFCLDAALAQSASLRA |
Ga0307471_1027677532 | 3300032180 | Hardwood Forest Soil | ARAGRKLGHVTLRASSPEQLASRLAELPTYFHRPEFCLDAVLRHSVSARG |
Ga0307471_1040396051 | 3300032180 | Hardwood Forest Soil | RAASPERLALRLSELPAFFHRPDFCLDAALSHSASIRA |
⦗Top⦘ |