NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F101696

Metagenome Family F101696

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101696
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 47 residues
Representative Sequence VFFNRCASRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP
Number of Associated Samples 84
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.02 %
% of genes from short scaffolds (< 2000 bps) 93.14 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.039 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(23.529 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(33.333 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.80%    β-sheet: 0.00%    Coil/Unstructured: 66.20%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF04820Trp_halogenase 72.55
PF12831FAD_oxidored 10.78
PF01209Ubie_methyltran 6.86
PF00067p450 2.94
PF01979Amidohydro_1 0.98
PF13193AMP-binding_C 0.98
PF13450NAD_binding_8 0.98
PF00999Na_H_Exchanger 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 6.86
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 6.86
COG2124Cytochrome P450Defense mechanisms [V] 2.94
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.98
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.98
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.98
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.98
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.04 %
UnclassifiedrootN/A1.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_103686715All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300004009|Ga0055437_10280403All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005174|Ga0066680_10146543All Organisms → cellular organisms → Bacteria1474Open in IMG/M
3300005180|Ga0066685_10147557All Organisms → cellular organisms → Bacteria1598Open in IMG/M
3300005181|Ga0066678_10731231All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium658Open in IMG/M
3300005186|Ga0066676_10485753All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005332|Ga0066388_100503967All Organisms → cellular organisms → Bacteria → Proteobacteria1846Open in IMG/M
3300005332|Ga0066388_102814681All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300005332|Ga0066388_103173584All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium840Open in IMG/M
3300005336|Ga0070680_102006941All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium501Open in IMG/M
3300005440|Ga0070705_101782491All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005450|Ga0066682_10669362All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium642Open in IMG/M
3300005547|Ga0070693_100432360All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300005547|Ga0070693_101453467All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium534Open in IMG/M
3300005558|Ga0066698_10204945All Organisms → cellular organisms → Bacteria1350Open in IMG/M
3300005713|Ga0066905_100355416All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300005713|Ga0066905_101125036All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300005713|Ga0066905_101572818All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005764|Ga0066903_100031062All Organisms → cellular organisms → Bacteria → Proteobacteria6040Open in IMG/M
3300005764|Ga0066903_105861488All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium645Open in IMG/M
3300006173|Ga0070716_101828699All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → Victivallales → Victivallaceae → Victivallis → Victivallis vadensis503Open in IMG/M
3300006844|Ga0075428_100384579All Organisms → cellular organisms → Bacteria1504Open in IMG/M
3300006854|Ga0075425_100297697All Organisms → cellular organisms → Bacteria1856Open in IMG/M
3300006854|Ga0075425_100841497All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1050Open in IMG/M
3300006880|Ga0075429_100944764All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium754Open in IMG/M
3300006880|Ga0075429_101041373All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300006903|Ga0075426_10783182All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium717Open in IMG/M
3300007265|Ga0099794_10385152All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium732Open in IMG/M
3300009094|Ga0111539_11023129All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium960Open in IMG/M
3300009094|Ga0111539_11482253All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium787Open in IMG/M
3300009100|Ga0075418_11710969All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium684Open in IMG/M
3300009101|Ga0105247_10234947All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1246Open in IMG/M
3300009157|Ga0105092_10755271Not Available568Open in IMG/M
3300009814|Ga0105082_1118002All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium514Open in IMG/M
3300009816|Ga0105076_1082045All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium610Open in IMG/M
3300009822|Ga0105066_1142669All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium546Open in IMG/M
3300009837|Ga0105058_1060384All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium857Open in IMG/M
3300010046|Ga0126384_10452517All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1097Open in IMG/M
3300010046|Ga0126384_11996990All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium555Open in IMG/M
3300010048|Ga0126373_12706992All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium553Open in IMG/M
3300010359|Ga0126376_12730778All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium543Open in IMG/M
3300010362|Ga0126377_11618735All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium722Open in IMG/M
3300010362|Ga0126377_11718489All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium703Open in IMG/M
3300010398|Ga0126383_10148187All Organisms → cellular organisms → Bacteria2184Open in IMG/M
3300010400|Ga0134122_10518530All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1083Open in IMG/M
3300011421|Ga0137462_1152376All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012211|Ga0137377_10828444All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium858Open in IMG/M
3300012355|Ga0137369_10115051All Organisms → cellular organisms → Bacteria2185Open in IMG/M
3300012930|Ga0137407_11724653All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium597Open in IMG/M
3300012976|Ga0134076_10137002All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium994Open in IMG/M
3300015245|Ga0137409_10103269All Organisms → cellular organisms → Bacteria2643Open in IMG/M
3300015371|Ga0132258_11021320All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2090Open in IMG/M
3300015373|Ga0132257_100902176All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1108Open in IMG/M
3300016357|Ga0182032_10336569All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1203Open in IMG/M
3300016371|Ga0182034_11494717All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium592Open in IMG/M
3300016404|Ga0182037_10768631All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium829Open in IMG/M
3300016445|Ga0182038_11236794All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium666Open in IMG/M
3300018074|Ga0184640_10542610All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium508Open in IMG/M
3300018084|Ga0184629_10686601All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium516Open in IMG/M
3300020170|Ga0179594_10049009All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1420Open in IMG/M
3300021086|Ga0179596_10690760All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300021090|Ga0210377_10102849All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Haloferula → unclassified Haloferula → Haloferula sp. BvORR0711907Open in IMG/M
3300025569|Ga0210073_1072410All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium732Open in IMG/M
3300025885|Ga0207653_10150071All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium857Open in IMG/M
3300025885|Ga0207653_10320445All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium603Open in IMG/M
3300025918|Ga0207662_10481189All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium853Open in IMG/M
3300025941|Ga0207711_11660737All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium582Open in IMG/M
3300025941|Ga0207711_11754113All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium564Open in IMG/M
3300026089|Ga0207648_10924174All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium816Open in IMG/M
3300026324|Ga0209470_1026064All Organisms → cellular organisms → Bacteria3068Open in IMG/M
3300026497|Ga0257164_1069336All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium585Open in IMG/M
3300026529|Ga0209806_1049607All Organisms → cellular organisms → Bacteria1978Open in IMG/M
3300026536|Ga0209058_1152300All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1082Open in IMG/M
3300026552|Ga0209577_10173341All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300027384|Ga0209854_1059564All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium664Open in IMG/M
3300027384|Ga0209854_1081551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium573Open in IMG/M
3300027577|Ga0209874_1064483All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium924Open in IMG/M
3300027717|Ga0209998_10114753All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium675Open in IMG/M
3300031564|Ga0318573_10650949All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium567Open in IMG/M
3300031716|Ga0310813_10688092All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium912Open in IMG/M
3300031720|Ga0307469_10257275All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1410Open in IMG/M
3300031740|Ga0307468_100083800All Organisms → cellular organisms → Bacteria1828Open in IMG/M
3300031768|Ga0318509_10630568All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300031777|Ga0318543_10201171All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus884Open in IMG/M
3300031821|Ga0318567_10163173All Organisms → cellular organisms → Bacteria → Proteobacteria1236Open in IMG/M
3300031833|Ga0310917_10311745All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1065Open in IMG/M
3300031893|Ga0318536_10655201All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria524Open in IMG/M
3300031896|Ga0318551_10109716All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300031913|Ga0310891_10171935All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium714Open in IMG/M
3300031943|Ga0310885_10906874All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium505Open in IMG/M
3300032066|Ga0318514_10666448All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium553Open in IMG/M
3300032067|Ga0318524_10653859All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria554Open in IMG/M
3300032075|Ga0310890_11332938All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium588Open in IMG/M
3300032180|Ga0307471_101175926All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium932Open in IMG/M
3300032180|Ga0307471_102292487All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium681Open in IMG/M
3300032180|Ga0307471_103586304All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium549Open in IMG/M
3300032180|Ga0307471_103821838All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium533Open in IMG/M
3300032205|Ga0307472_100571538All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium991Open in IMG/M
3300032205|Ga0307472_102324586All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium543Open in IMG/M
3300033290|Ga0318519_10835250All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria568Open in IMG/M
3300034090|Ga0326723_0534687All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium540Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.78%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil7.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.86%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand6.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300009837Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300025569Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027384Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10368671523300000955SoilYHVPVVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP*
Ga0055437_1028040323300004009Natural And Restored WetlandsPVVPPRPGIGVFFNRCGSRNNLVVSWIEGVVSRDEAARIIEVVRDGMGWAGLP*
Ga0066680_1014654323300005174SoilHAPAVLPRPGIGVFFNRCAGTNNLVTSWVDGAVTEAEVAQIVEVVRDGMEWTRVP*
Ga0066685_1014755713300005180SoilVVPPRPGIGVFFNRCGGRNNLVVSWIEGVVTEPESARIIEVIREGMGWSAV*
Ga0066678_1073123123300005181SoilFNRCRGRNNLVVSWIEGVVTESEAARIIDVVSEGMGWTEAS*
Ga0066676_1048575313300005186SoilPRPGIGVFFNRCATRSNLVISWIEGAAAEDEVGRIVEVVREGMGWTRIP*
Ga0066388_10050396733300005332Tropical Forest SoilPVVPPRPGIGVFFNRCGGRSNVVVSWIEGVVTEVEAARIIEVVREEMGWIDAS*
Ga0066388_10281468123300005332Tropical Forest SoilRPGIGVFFNRCGNRNNLVVSWLEGVVSREDAARIIEVVRDGMGWTR*
Ga0066388_10317358423300005332Tropical Forest SoilGVFFNRCGGRNNLVVSWIEGVVSDAEATRVMEVVREGMGWSAAS*
Ga0070680_10200694113300005336Corn RhizosphereLGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP*
Ga0070705_10178249113300005440Corn, Switchgrass And Miscanthus RhizosphereRVVNAYHIPVVPPRPGLGVFFNRCGNRNNIVVSWMAGVVSRDEAARIIEVVRDGMGWKR*
Ga0066689_1055350313300005447SoilVLPRPGIGVFFNRCSTRNNLVISWIDGAAREDDVTRIAEVVREGMGWAEVP*
Ga0066682_1066936223300005450SoilNRCGSRSNLVVSWIEGVVSEAEVARIIELVRDGMGWTATP*
Ga0070693_10043236013300005547Corn, Switchgrass And Miscanthus RhizosphereYHIPVVPPRPGLGVFFNRCGNRNNIVVSWMAGVVSRDEAARIIEVVRDGMGWKR*
Ga0070693_10145346713300005547Corn, Switchgrass And Miscanthus RhizosphereGIGVFFNRCAGRNNLVVSWIEGVVSDAEAARIIEVIREGMGWTGMESPA*
Ga0066698_1020494523300005558SoilPVVPPRPGIGVFFNRCGGRNNLVVSWIEGVVTDIEAARIVEVIREGMGWSGAN*
Ga0066905_10035541613300005713Tropical Forest SoilVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVVRDGMGWTRTP*
Ga0066905_10112503623300005713Tropical Forest SoilVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRAGMGWTRTP*
Ga0066905_10157281813300005713Tropical Forest SoilYHIPVVPPRPGLGVFFNRCGRRHNVVVSWMAGVASRDEVARIVEVIRDGMGWTRAA*
Ga0066903_10003106213300005764Tropical Forest SoilGVFFNRCGSRNNLVVSWIEGAVSDEDVARIIEVVRDGMGWASMS*
Ga0066903_10586148823300005764Tropical Forest SoilGLGVFFNRCGSRHNLVVSWLEGVVERDDAARIIEAVRDGMGWTRCASDD*
Ga0070716_10182869913300006173Corn, Switchgrass And Miscanthus RhizosphereHVPVVPPRPGIGVFFNRCAGRNNLVVSWIEGVVSDAEAARIIEVIREGMGWTGMESPA*
Ga0075428_10038457923300006844Populus RhizospherePVVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP*
Ga0075425_10029769713300006854Populus RhizosphereGRNNLVVSWIEGVATEGEADTIIETIRREMGWTIAP*
Ga0075425_10084149723300006854Populus RhizosphereRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP*
Ga0075429_10094476423300006880Populus RhizosphereRPGIGVFFNRCAGRWNLVVSFIEGVVSEDEVARVIEIVARGMGWTRAV*
Ga0075429_10104137313300006880Populus RhizosphereVVNGYHAPAVLPRPGVGVFFNRYGATSNLVVSWIDGVVSDDDVAQIVEVVREGMGWAKCA
Ga0075426_1078318223300006903Populus RhizosphereCGGRNNLVVSWIEGVVSEAEASRIMEVVREGMGWSAAN*
Ga0099794_1038515223300007265Vadose Zone SoilVPPRPALGVFFNRCENLDNIVVSWLEGVITDTEAARIIEVIRDGMGWTRTP*
Ga0111539_1102312913300009094Populus RhizospherePVVPPRPGVGVFFNRCGGRNNVVVSWIEGVVNEVEARRIVEVIREGMGWSTAQ*
Ga0111539_1148225313300009094Populus RhizosphereDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP*
Ga0075418_1171096913300009100Populus RhizospherePPRPGVGVFFNRCGGRNNVVVSWIEGVVNEVEARRIVEVIREGMGWSTAQ*
Ga0105247_1023494713300009101Switchgrass RhizosphereRCGNRNNVVVSWMEGVVSRDEAARIIEVVRDGMGWTRSR*
Ga0105092_1075527123300009157Freshwater SedimentGIGVFFNRWRSNLVVSWIEGVVSEGEVTGIVEAVTEGMGWSPRL*
Ga0105082_111800223300009814Groundwater SandGIGVFFNRCESRNNLVVSWIEGVVSDAEAARIVEVVRNGMGWTRTP*
Ga0105076_108204523300009816Groundwater SandVFFNRCASRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP*
Ga0105066_114266913300009822Groundwater SandNRCGIRNNLVVSWIEGAVTEDEVRRVVEIVREGMGWTRAR*
Ga0105058_106038423300009837Groundwater SandCESRNNLVVSWIEGVVSDAEAARIIEVIRDGMGWTRTP*
Ga0126384_1045251723300010046Tropical Forest SoilVVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP*
Ga0126384_1199699023300010046Tropical Forest SoilVVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVVRDGMGWTRTP*
Ga0126373_1270699223300010048Tropical Forest SoilENNLVVSWLEGVVTRQEAERIIEVVRDGMGWRTAA*
Ga0126376_1273077813300010359Tropical Forest SoilALGVFLNRCENLDNMVVSWLEGAITDTEAARITEVIRDGMGWTRTP*
Ga0126377_1161873513300010362Tropical Forest SoilPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVVRDGMGWTRTP*
Ga0126377_1171848923300010362Tropical Forest SoilPGVGVFFNRYGASSNLVVSWIEDVVNDDDVAQIVEVVREGMGWAKRS*
Ga0126383_1014818733300010398Tropical Forest SoilPRPGIGVFFNRCGGRSNVVVSWIEGVVTEAEAARIIEVVREEMGWSVS*
Ga0134122_1051853013300010400Terrestrial SoilGVFFNRCAGRNNVVVSWIDGVVSDAEAARIIEVIREGMGWLETDSQV*
Ga0137462_115237623300011421SoilFNRCGNRNNVVVSWMEGVVSRDEAARIIEVVREGMGWTR*
Ga0137377_1082844423300012211Vadose Zone SoilIGVFFNRCGRRNNLVVSWIEGVVSEAEADRILEVIREAMGWSLAP*
Ga0137369_1011505133300012355Vadose Zone SoilGIGVFFNRCASRNNLVVSWIEGVVSDAEAARIIEVIRDGMEWARTP*
Ga0137407_1172465323300012930Vadose Zone SoilFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP*
Ga0134076_1013700223300012976Grasslands SoilFNRCENLDNIVVSWLEGAITDTEAARIIELIRDGMGWTRTP*
Ga0137409_1010326953300015245Vadose Zone SoilIGVFFNRCGSRNNLVVSWIEGVVSETEVARIVELVRDGMGWTAAP*
Ga0132258_1102132023300015371Arabidopsis RhizosphereCAGRNNLVVSWIEGVVSDAEAARIIEVIREGMGWTGMESPGQAR*
Ga0132257_10090217623300015373Arabidopsis RhizosphereAPAVLPRPGVGVFFNRYGATSNLVVSWIDGVVSDDDVAQIVEVVREGMGWAKCA*
Ga0182032_1033656923300016357SoilNRCGDLNNVVVSWIEGVATETEAQRILEVVREEMGWTVAS
Ga0182034_1149471713300016371SoilGIGVFFNRCGDLNNVVVSWIEGVPIETEAQRILEVVREEVGWTVAS
Ga0182037_1076863113300016404SoilGVFFNRCAGRNNLVVSWIEGVVDDAEATKVIEAIRVGMGWIESERQA
Ga0182038_1123679413300016445SoilIGVFFNRCGDLNNVVVSWIEGVATETEAQRILEVVREEMGWTVAS
Ga0184640_1054261013300018074Groundwater SedimentASRNNLVVSWIEGVVSDAEAERIIEVIRDGMRWTRTP
Ga0184629_1068660113300018084Groundwater SedimentRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP
Ga0179594_1004900923300020170Vadose Zone SoilIVPPRPALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP
Ga0179596_1069076023300021086Vadose Zone SoilFFNRCESRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP
Ga0210377_1010284933300021090Groundwater SedimentPGIGVFFNRCSTTNNLVTSWIDGAVSDDEVTRIMEVVSEGMKWTRTPGAAAP
Ga0210073_107241013300025569Natural And Restored WetlandsGSRNNLVVSWLDGVVERDDAARIIEVVRDGMGWTPQR
Ga0207653_1015007113300025885Corn, Switchgrass And Miscanthus RhizosphereVNAYHIPVVPPRPGLGVFFNRCGNRNNIVVSWMAGVVSRDEAARIIEVVRDGMGWKR
Ga0207653_1032044523300025885Corn, Switchgrass And Miscanthus RhizosphereGVFFNRCGGRNNLVVSWIEGVVSEAAADRILEVIREAMGWRVAP
Ga0207662_1048118913300025918Switchgrass RhizospherePALGVFFNRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP
Ga0207711_1166073723300025941Switchgrass RhizosphereYHIPVVPPRPGLGVFFNRCGNRNNVVVSWMEGVVSRDEAARIIEVVREGMGWTRSP
Ga0207711_1175411313300025941Switchgrass RhizospherePGIGVFFNRCGNRNNVVVSWMEGVVSRDEAARIIEVVRDGMGWTRSR
Ga0207648_1092417413300026089Miscanthus RhizosphereRPGIGVFFNRCGGRNNLVVSWIEGVVSEAEADRILEVIREAMGWRVAP
Ga0209470_102606443300026324SoilGIGVFFNRCAARNNLVISWVEGAVSEKEVARIIEVVREGMEWVSIP
Ga0257164_106933623300026497SoilPVVPPRPGIGVFFNRCGGRNNLVVSWIEGVVSEVEAARIMEVIREGMGWTATC
Ga0209806_104960733300026529SoilGIGVFFNRCGGRSNLVVSWIEGVVTEAEAARIVEVIREGMGWSAAN
Ga0209058_115230013300026536SoilLPRPGIGVFFNRCAARNNLVISWIEGAVSEKEVARIIEVVREGMEWVSIP
Ga0209577_1017334113300026552SoilVVPPRPGIGVFFNRCGGRSNLVVSWIEGVVTEAEAARIVEVIREGMGWSAAN
Ga0209854_105956423300027384Groundwater SandCEGRNNLVVSWIEGVVSEAEVARIIEVVREGMGWTAAP
Ga0209854_108155113300027384Groundwater SandVPPRPGIGVFFNRCENRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP
Ga0209874_106448313300027577Groundwater SandVVPPRPGIGVFFNRCESRNNLVVSWIEGVVSDAEAARIIEVVRDGMGWTRTP
Ga0209998_1011475313300027717Arabidopsis Thaliana RhizosphereRVVNAYHIPVVPPRPGLGVFFNRCGNRNNIVVSWMAGVVSRDEAARIIEVVRDGMGWKR
Ga0318573_1065094913300031564SoilFNRCGPRENVIVSWIEGVLNEVEAARIIEVIREALGWTRTT
Ga0310813_1068809213300031716SoilNRCGGRNNLVVSWIEGVVSEAEADRILEVIREAMGWRVAP
Ga0307469_1025727523300031720Hardwood Forest SoilYHAPAVLPRPGIGVFFNRCATRHNLVVSWIEGAASEGDVAQIVEVVRAGMGWARTA
Ga0307468_10008380013300031740Hardwood Forest SoilRCENLDNIVVSWLEGAITDTEAARIIEVIRDGMGWTRTP
Ga0318509_1063056823300031768SoilVVPPRPGIGVFFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMGWIETQRSA
Ga0318543_1020117113300031777SoilRCGGRSNVVVSWIEGVVTEVEAARIIDVVREEMGWIDAS
Ga0318567_1016317313300031821SoilGIGVFFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMGWTETAWSA
Ga0310917_1031174523300031833SoilRPGIGVFFNRCGDLNNVVVSWIEGVATETEAQRILEVVREEMGWTVAS
Ga0318536_1065520113300031893SoilRPGIGVFFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMGWTETAWSA
Ga0318551_1010971643300031896SoilNNLVVSWIEGVASDAEAARIIEVIREGMGWTETAWSA
Ga0310891_1017193523300031913SoilPRPGVGVFFNRCGGRNNVVVSWIEGVVNEVDARRIVEVIREGMGWSTAQ
Ga0310885_1090687423300031943SoilGVFFNRCGGRNNLVVSWIEGVVSEAEADRILEVIREAMGWTVAR
Ga0318514_1066644823300032066SoilVPVVPPRPGIGVFFNRCGDLNNVVVSWIEGVATETEAQRILEVVREEMGWTVAS
Ga0318524_1065385913300032067SoilFFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMRWTETAWSA
Ga0310890_1133293823300032075SoilPRPGIGVFFNRCGSRNNLVVSWIEGVATEGEADTIIETIRREMGWTTAP
Ga0307471_10117592613300032180Hardwood Forest SoilVFFNRCGNRNNLVVSWLEGVVSREDAARIIEVVRDAMGWSA
Ga0307471_10229248723300032180Hardwood Forest SoilPRPALGVFFNRCENLDNIVVSWLEGAITDTEASRIIEVIRDGMGWTRTA
Ga0307471_10358630413300032180Hardwood Forest SoilFFNRCWGRSNLVVSWIEGVVTEVEAARIAEVIREGMGWSAAN
Ga0307471_10382183823300032180Hardwood Forest SoilVPPRPGIGVFFNRCGSRNNIVVSWIEGVVNEGEAARIIEVVRDALGWMRTP
Ga0307472_10057153823300032205Hardwood Forest SoilLDNIVVSWLEGAITDTEAARIIEVIRGGMGWTRTP
Ga0307472_10232458623300032205Hardwood Forest SoilGVFFNRCGNRNNVVVSWMEGVVSRDEAARIIEVVREGMGWTR
Ga0318519_1083525023300033290SoilPVVPPRPGIGVFFNRCAGHNNLVVSWIEGVASDAEAARIIEVIREGMRWTETAWSA
Ga0326723_0534687_431_5383300034090Peat SoilGNRNNVVVSWMEGVVSRDEAARIIEVVREGMGWTR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.