| Basic Information | |
|---|---|
| Family ID | F101683 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RFIKVFPHEFKRVLGVSRCEQAYIPGEPVAVLANAEQVQHG |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 98.04 % |
| % of genes from short scaffolds (< 2000 bps) | 91.18 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.902 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.804 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.490 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.882 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.14% β-sheet: 0.00% Coil/Unstructured: 89.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF14691 | Fer4_20 | 92.16 |
| PF04253 | TFR_dimer | 2.94 |
| PF07992 | Pyr_redox_2 | 0.98 |
| PF00291 | PALP | 0.98 |
| PF13620 | CarboxypepD_reg | 0.98 |
| PF13559 | DUF4129 | 0.98 |
| PF14534 | DUF4440 | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.90 % |
| All Organisms | root | All Organisms | 45.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002906|JGI25614J43888_10215882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 519 | Open in IMG/M |
| 3300002914|JGI25617J43924_10126567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 896 | Open in IMG/M |
| 3300004092|Ga0062389_100074649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2865 | Open in IMG/M |
| 3300004476|Ga0068966_1355226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 591 | Open in IMG/M |
| 3300004479|Ga0062595_102271074 | Not Available | 534 | Open in IMG/M |
| 3300005540|Ga0066697_10129034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1486 | Open in IMG/M |
| 3300005541|Ga0070733_10851099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 612 | Open in IMG/M |
| 3300005575|Ga0066702_10595113 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300005764|Ga0066903_102895374 | Not Available | 931 | Open in IMG/M |
| 3300005921|Ga0070766_10842744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 626 | Open in IMG/M |
| 3300005995|Ga0066790_10049200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1825 | Open in IMG/M |
| 3300006086|Ga0075019_10457141 | Not Available | 787 | Open in IMG/M |
| 3300006174|Ga0075014_100342232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 800 | Open in IMG/M |
| 3300006903|Ga0075426_11075280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 609 | Open in IMG/M |
| 3300006914|Ga0075436_101314818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 547 | Open in IMG/M |
| 3300009520|Ga0116214_1124071 | Not Available | 955 | Open in IMG/M |
| 3300009521|Ga0116222_1251069 | Not Available | 763 | Open in IMG/M |
| 3300009522|Ga0116218_1455378 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009627|Ga0116109_1081536 | Not Available | 663 | Open in IMG/M |
| 3300009672|Ga0116215_1052488 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300009698|Ga0116216_10035344 | Not Available | 3100 | Open in IMG/M |
| 3300010043|Ga0126380_11787981 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010359|Ga0126376_10397042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium IMCC9480 | 1241 | Open in IMG/M |
| 3300010361|Ga0126378_13398790 | Not Available | 505 | Open in IMG/M |
| 3300010366|Ga0126379_10680391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
| 3300010376|Ga0126381_100576496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis → Mycobacterium tuberculosis str. Haarlem | 1598 | Open in IMG/M |
| 3300011120|Ga0150983_13688496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 649 | Open in IMG/M |
| 3300012202|Ga0137363_11166181 | Not Available | 655 | Open in IMG/M |
| 3300012203|Ga0137399_11274106 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012353|Ga0137367_10898406 | Not Available | 610 | Open in IMG/M |
| 3300012927|Ga0137416_10994964 | Not Available | 749 | Open in IMG/M |
| 3300012927|Ga0137416_11237746 | Not Available | 673 | Open in IMG/M |
| 3300012988|Ga0164306_11220450 | Not Available | 631 | Open in IMG/M |
| 3300014165|Ga0181523_10152583 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300014838|Ga0182030_10089667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4351 | Open in IMG/M |
| 3300016702|Ga0181511_1475933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1873 | Open in IMG/M |
| 3300017822|Ga0187802_10102563 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → environmental samples → Prevotella sp. CAG:487 | 1077 | Open in IMG/M |
| 3300017943|Ga0187819_10561806 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300017948|Ga0187847_10757284 | Not Available | 548 | Open in IMG/M |
| 3300017966|Ga0187776_10733698 | Not Available | 702 | Open in IMG/M |
| 3300017972|Ga0187781_10350748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium ADurb.Bin100 | 1050 | Open in IMG/M |
| 3300017972|Ga0187781_11392908 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300017999|Ga0187767_10284081 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300018013|Ga0187873_1291271 | Not Available | 600 | Open in IMG/M |
| 3300018033|Ga0187867_10400714 | Not Available | 760 | Open in IMG/M |
| 3300018046|Ga0187851_10268352 | Not Available | 996 | Open in IMG/M |
| 3300018057|Ga0187858_10372442 | Not Available | 892 | Open in IMG/M |
| 3300019268|Ga0181514_1087489 | Not Available | 855 | Open in IMG/M |
| 3300019785|Ga0182022_1035625 | Not Available | 712 | Open in IMG/M |
| 3300020582|Ga0210395_10234897 | Not Available | 1377 | Open in IMG/M |
| 3300020583|Ga0210401_10163479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2078 | Open in IMG/M |
| 3300021088|Ga0210404_10425843 | Not Available | 744 | Open in IMG/M |
| 3300021171|Ga0210405_10758707 | Not Available | 746 | Open in IMG/M |
| 3300021406|Ga0210386_11122091 | Not Available | 667 | Open in IMG/M |
| 3300021433|Ga0210391_11047514 | Not Available | 634 | Open in IMG/M |
| 3300021475|Ga0210392_10820044 | Not Available | 695 | Open in IMG/M |
| 3300021560|Ga0126371_12278089 | Not Available | 654 | Open in IMG/M |
| 3300022532|Ga0242655_10013339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1630 | Open in IMG/M |
| 3300022850|Ga0224552_1011260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1221 | Open in IMG/M |
| 3300025480|Ga0208688_1070176 | Not Available | 714 | Open in IMG/M |
| 3300025915|Ga0207693_11291203 | Not Available | 546 | Open in IMG/M |
| 3300025928|Ga0207700_10980641 | Not Available | 756 | Open in IMG/M |
| 3300025937|Ga0207669_10357261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300026142|Ga0207698_10890466 | Not Available | 897 | Open in IMG/M |
| 3300026309|Ga0209055_1030478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2472 | Open in IMG/M |
| 3300026319|Ga0209647_1325552 | Not Available | 519 | Open in IMG/M |
| 3300027505|Ga0209218_1040909 | Not Available | 921 | Open in IMG/M |
| 3300027537|Ga0209419_1123840 | Not Available | 516 | Open in IMG/M |
| 3300027645|Ga0209117_1090997 | Not Available | 843 | Open in IMG/M |
| 3300027662|Ga0208565_1216027 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027795|Ga0209139_10068913 | Not Available | 1241 | Open in IMG/M |
| 3300027829|Ga0209773_10367746 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300027846|Ga0209180_10756782 | Not Available | 523 | Open in IMG/M |
| 3300027853|Ga0209274_10541771 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027854|Ga0209517_10144650 | Not Available | 1529 | Open in IMG/M |
| 3300027903|Ga0209488_10239026 | Not Available | 1363 | Open in IMG/M |
| 3300027908|Ga0209006_10017185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6555 | Open in IMG/M |
| 3300027986|Ga0209168_10001879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15831 | Open in IMG/M |
| 3300028800|Ga0265338_10835342 | Not Available | 630 | Open in IMG/M |
| 3300028873|Ga0302197_10294262 | Not Available | 733 | Open in IMG/M |
| 3300028906|Ga0308309_10275137 | Not Available | 1417 | Open in IMG/M |
| 3300029636|Ga0222749_10466619 | Not Available | 678 | Open in IMG/M |
| 3300030339|Ga0311360_10541701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 932 | Open in IMG/M |
| 3300030509|Ga0302183_10297594 | Not Available | 624 | Open in IMG/M |
| 3300030520|Ga0311372_11679110 | Not Available | 767 | Open in IMG/M |
| 3300031057|Ga0170834_106579354 | Not Available | 579 | Open in IMG/M |
| 3300031231|Ga0170824_109218071 | Not Available | 1032 | Open in IMG/M |
| 3300031446|Ga0170820_12953596 | Not Available | 631 | Open in IMG/M |
| 3300031446|Ga0170820_16168912 | Not Available | 512 | Open in IMG/M |
| 3300031524|Ga0302320_10719023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
| 3300031708|Ga0310686_108106801 | Not Available | 1344 | Open in IMG/M |
| 3300031711|Ga0265314_10242677 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → environmental samples → Prevotella sp. CAG:487 | 1038 | Open in IMG/M |
| 3300031753|Ga0307477_11157163 | Not Available | 503 | Open in IMG/M |
| 3300031754|Ga0307475_10101767 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300031788|Ga0302319_11374672 | Not Available | 638 | Open in IMG/M |
| 3300032059|Ga0318533_11186762 | Not Available | 559 | Open in IMG/M |
| 3300032160|Ga0311301_11036533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis → Mycobacterium tuberculosis str. Haarlem | 1078 | Open in IMG/M |
| 3300032160|Ga0311301_12385354 | Not Available | 598 | Open in IMG/M |
| 3300032180|Ga0307471_104265287 | Not Available | 505 | Open in IMG/M |
| 3300033002|Ga0346503_1043432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2381 | Open in IMG/M |
| 3300033158|Ga0335077_10299910 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| 3300033433|Ga0326726_10199115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1848 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.92% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.92% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.98% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009627 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022850 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 1-5 | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033002 | Soil microbial community from agricultural field in Dibrughar, Assam, India - D1 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25614J43888_102158821 | 3300002906 | Grasslands Soil | RFIKVFPHEYKRVQGVTRTQQPYVPGQLLPVEAAVGQVQHG* |
| JGI25617J43924_101265671 | 3300002914 | Grasslands Soil | EALSRFIKVFPHEHKRVLGVSRRRQPYIPSLPMAVLSTPQEVQHG* |
| Ga0062389_1000746493 | 3300004092 | Bog Forest Soil | FVKVFPHEFKRVLGVSRSQRAYIPKQPVSVLAPIEPVQQVQHG* |
| Ga0068966_13552261 | 3300004476 | Peatlands Soil | VASRFIKVFPHEFKRVLGVVRSRHAYIPGQSVSVLAHAEQVQHG* |
| Ga0062595_1022710742 | 3300004479 | Soil | RFIKVFPHEFKRVLGVSRSDEAYIPGEAVSILDDAEQVQHG* |
| Ga0066697_101290341 | 3300005540 | Soil | EMLPRFIKVFPHEFKRVLGVPRSTQAYIPGETMAVLEEAEQVQHG* |
| Ga0070733_108510991 | 3300005541 | Surface Soil | FIKVFPHEFKRVLGVSRSQQAYIPGEQAAVLANAEQVQHG* |
| Ga0066702_105951132 | 3300005575 | Soil | FPHEFKRVLGVSRSEQAYIPGEAVAVLADAEQVQHG* |
| Ga0066903_1028953741 | 3300005764 | Tropical Forest Soil | VFPHEYKRVLGVARAEQAYIPGQSVPVLVNAEQVQHG* |
| Ga0070766_108427441 | 3300005921 | Soil | VFPHEFKRVLGVARAEQAYIPGESLAVLANAEQVQHG* |
| Ga0066790_100492001 | 3300005995 | Soil | SRFIKVFPHEHKRVLGVSRRRQPYIPSPQLAVTAQAEQVHHG* |
| Ga0075019_104571412 | 3300006086 | Watersheds | FPHEHKRVLGVSRRRQPYVPNPAFAATLTGPQVQHG* |
| Ga0075014_1003422321 | 3300006174 | Watersheds | VFPHEFKRVLGVVRSQQACTPAQPVAVLEPVEQVQHG* |
| Ga0075426_110752801 | 3300006903 | Populus Rhizosphere | RFIKVFPHEFKRVLGVSRSHEAYIPGEPVSILENAEQVQHG* |
| Ga0075436_1013148182 | 3300006914 | Populus Rhizosphere | FMKVFPHEFKRVLGIPRVGHAYVPGQVPMLLIAEQVQHG* |
| Ga0116214_11240712 | 3300009520 | Peatlands Soil | MLSRFIKVFPPEFKGVLGAPSSEQVYSPNDPVAVVADAEQLQPEQVQHG* |
| Ga0116222_12510691 | 3300009521 | Peatlands Soil | IKVFPHEFKRVLGVARSEQAYIPNQPVAVLAEPEPMQEQVQHG* |
| Ga0116218_14553782 | 3300009522 | Peatlands Soil | VFPHEHKRVLGVSRRRQPYIPSPPLAVLSPPEQVQHG* |
| Ga0116109_10815362 | 3300009627 | Peatland | LARFIKVFPHEHKRVLGMTRRRQPYIPGAALAVAAQSEQVSHG* |
| Ga0116215_10524883 | 3300009672 | Peatlands Soil | VFPHEHKRVLGVSRRRQPYIPSPPPAEPAPAEQVQHG* |
| Ga0116216_100353441 | 3300009698 | Peatlands Soil | PHEFKRVLGVARSEQAYIPNQPVAVLAEPEPMQEQVQHG* |
| Ga0126380_117879812 | 3300010043 | Tropical Forest Soil | PRFIKVFPHEFKRVLGVSRSEQTYIPVESVSVLAVEQVQHG* |
| Ga0126376_103970422 | 3300010359 | Tropical Forest Soil | EASLRFIKVFPHEFKRVLGVSRCAHAHIPGESLAVLASAEQVQHG* |
| Ga0126378_133987902 | 3300010361 | Tropical Forest Soil | FPHEYKRVLGVARAEQAYIPSDAVALSVNAEQVQHG* |
| Ga0126379_106803912 | 3300010366 | Tropical Forest Soil | PHEYKRVLGVARAEQAYIPGQSVPVLVNAEQVQHG* |
| Ga0126381_1005764961 | 3300010376 | Tropical Forest Soil | ASLRFIKVFPHEYKRVLGVARAEQPYIPSDAVALSVNAEQVQHG* |
| Ga0150983_136884962 | 3300011120 | Forest Soil | WNEAVSRFIKVFPHEFKRVLGIARAEQAYIPGEPLAVLANAEQVQHG* |
| Ga0137363_111661811 | 3300012202 | Vadose Zone Soil | MLPRFIKVFPHEFKRVLGVSRTQQPYIPGPNLPVIAVPEQVQHG* |
| Ga0137399_112741062 | 3300012203 | Vadose Zone Soil | FPHEFKRVLGVSRTPQPYLPGPNLPAGVAPEQVQHG* |
| Ga0137367_108984061 | 3300012353 | Vadose Zone Soil | VFPHEFKRVLGVTRSEQAYVPGEAGAASLHPEQVQHG* |
| Ga0137416_109949641 | 3300012927 | Vadose Zone Soil | KVFPHEHKRVLGVGRRRQPYIPSPALTAVAQAAQVQHG* |
| Ga0137416_112377462 | 3300012927 | Vadose Zone Soil | WLALLPRFIKVYPHEFKRVQGVTRTQQPYIPGQLLPVEAAAGQVQHG* |
| Ga0164306_112204501 | 3300012988 | Soil | SWFIKVFPHEFKRVLGVRRSEHAYIPSQSDAILAHAEPGQSEQVQHG* |
| Ga0181523_101525831 | 3300014165 | Bog | SLSRFIKVFPHEHKRVLGVSRRRQPYIPSPPLAVLSSPEQVQHG* |
| Ga0182030_100896674 | 3300014838 | Bog | NNWTEALARFIKVFPHEHKRVLGMTRRQQPYIPGAALAVAAQSEQVSHG* |
| Ga0181511_14759333 | 3300016702 | Peatland | FIKVFPHEHKRVLGVSRRRQPYIPSPPADVLVSAEQVQHG |
| Ga0187802_101025632 | 3300017822 | Freshwater Sediment | VFPHEFKRVLGVLRSQQAYTPGQAVAVLEPVEQVQHG |
| Ga0187819_105618062 | 3300017943 | Freshwater Sediment | RFIKVFPHELKRVLGVSRTHQAYVPGQSLPAMPAAEQVQHG |
| Ga0187847_107572842 | 3300017948 | Peatland | RFIKVFPHEFKRVLGVARASQAYIPNQPVAVLAEADHAQHEHVQHGQVIHG |
| Ga0187776_107336981 | 3300017966 | Tropical Peatland | KVFPHEYKRILGVPRVDQAYIPSETIAVLANAEQMQHG |
| Ga0187781_103507482 | 3300017972 | Tropical Peatland | FPHEYKRVLGVKRCPQPYIPSLPLALFAPAEQVQRG |
| Ga0187781_113929082 | 3300017972 | Tropical Peatland | RFIKVFPHEFKRVLGVSRCEQAYIPGEPVAVLANAEQVQHG |
| Ga0187767_102840812 | 3300017999 | Tropical Peatland | KVFPHEYKRVLGVSRLRKPYIAGQPFPPTVELAEQVQHG |
| Ga0187873_12912711 | 3300018013 | Peatland | FKRVLGVGRSEQAYIPSQAVSVLADREQMQHEQVQHG |
| Ga0187867_104007141 | 3300018033 | Peatland | LDNWSEALSRFIKVFPHEHKRVLGVGRRRQPYIPSPPLAVLSSPEQVQHG |
| Ga0187851_102683521 | 3300018046 | Peatland | EMLSRFIKVFPHEHKRVLGLRRRRPPYNPSPPLAVPVPAEQVRHG |
| Ga0187858_103724422 | 3300018057 | Peatland | KVFPHEFKRVLGVGRSEQAYIPSQAVSVLADREQMQHEQVQHG |
| Ga0181514_10874891 | 3300019268 | Peatland | YEVLPRFIKIFPHEFKRVSGVSRSDQPYIPGSSEQAVVSGEQVQHG |
| Ga0182022_10356251 | 3300019785 | Fen | RFIKVFPHEFKRVLRVSRTRQPYIPGQSLPVMAVAEQVRHG |
| Ga0210395_102348971 | 3300020582 | Soil | IKVFPHEFKRVLGIGRRPQAYMPSEPVAVLAHAEQAQNEQVQHG |
| Ga0210401_101634793 | 3300020583 | Soil | SRFIKVFPHEHKRVLGVSLRRQPYIPTPALTAVAQAQQVQHG |
| Ga0210404_104258431 | 3300021088 | Soil | IKVFPHEYKRVQGVTRAQQPYIPGQLLSVEAGVGQVRHG |
| Ga0210405_107587072 | 3300021171 | Soil | FPHEFKRVLGVARSEHAYIPSQPVAILADAEQAQQEQLQHGQVLHG |
| Ga0210386_111220912 | 3300021406 | Soil | KVFPHEFKRVLGVARSEQAYIPNQPVSILAKAEPMQQEQVQHG |
| Ga0210391_110475142 | 3300021433 | Soil | LPRFIKVFPHEFKRVLGVSRNRAPYIPIAPIAVLAAAEQVQHG |
| Ga0210392_108200441 | 3300021475 | Soil | ASRFIKVFPHEFKRVLGVNRREQAYIPASAVAVLAQSESLQPEQVQLG |
| Ga0126371_122780892 | 3300021560 | Tropical Forest Soil | SRFIKVFPHEYKRVLGVPRHEQAYVPEPVMAQAEQVQHG |
| Ga0242655_100133392 | 3300022532 | Soil | FIKVFPHEFKRVLGIARAEQAYIPGEPLAVLANAEQVQHG |
| Ga0224552_10112601 | 3300022850 | Soil | SETLSRFIKVFPHEHKRVLGVRRRRPPYNPSPLLAVPAPAEQVHHG |
| Ga0208688_10701761 | 3300025480 | Peatland | FIKVFPHEHKRVLGVSRRRQPYIPSPLIAAMAPPEQVQHG |
| Ga0207693_112912032 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VFPHEFKRVLGVSRSRHAYIPGEAVAVLADAEQVQHG |
| Ga0207700_109806412 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IKVFPHEHKRVLGVSRRRTPYIPSLPVNVLVPLEQMQHG |
| Ga0207669_103572611 | 3300025937 | Miscanthus Rhizosphere | KVFPHEFKRVLGVSRSQQPYVPGAPLPVPVAVEEQVHHG |
| Ga0207698_108904662 | 3300026142 | Corn Rhizosphere | MRFIKVFPHEFKRVLGVSRSQQPYVPGAPLPVPVAVEEQVHHG |
| Ga0209055_10304781 | 3300026309 | Soil | NEAVSRFIKVFPHEFKRVLGIARAEQAYIPGEPLAVLANAEQVQHG |
| Ga0209647_13255522 | 3300026319 | Grasslands Soil | RFIKVFPHEYKRVQGVTRTQQPYVPGQLLPVEAAVGQVQHG |
| Ga0209218_10409092 | 3300027505 | Forest Soil | PHEFKRVLGVGRNQQAYIPSHPVSVLAQVEQVQNG |
| Ga0209419_11238401 | 3300027537 | Forest Soil | EFKRVLGVGRSERAYIPSRPVPVLVSTEPMHPEQVQHG |
| Ga0209117_10909972 | 3300027645 | Forest Soil | IKVFPHEFKRVLGVGRSERAYIPSRPVPVLVSNEQMQPEQVQHG |
| Ga0208565_12160271 | 3300027662 | Peatlands Soil | SRFIKVFPHEFKRVLGLNRSPQPYIPNQPLPVLAQVEQVQHG |
| Ga0209139_100689131 | 3300027795 | Bog Forest Soil | FPHEHKRVLGVTRSRQPYIPSAPLVASENITDTPAQVQHG |
| Ga0209773_103677461 | 3300027829 | Bog Forest Soil | SRFIKVFPHEHKRVLGVNRSRQPYIPSPPLAALVPAEQVQHG |
| Ga0209180_107567822 | 3300027846 | Vadose Zone Soil | FIKVFPHEYKRVRGVTRTQQPYIPGQLLSVEAGAEQVRHG |
| Ga0209274_105417712 | 3300027853 | Soil | KVFPHEHKRVLGVSRRRQPYIPSAPLDTLVQAEQVQHG |
| Ga0209517_101446501 | 3300027854 | Peatlands Soil | KVFPHEFKRVLGVARSEQAYIPNQPVAVLAEPEPMQEQVQHG |
| Ga0209488_102390262 | 3300027903 | Vadose Zone Soil | FPHEFKRVLGVSRTTQPYLPGPNLPVVAAAEQVQHG |
| Ga0209006_100171851 | 3300027908 | Forest Soil | FIKVFPHEFKRVLGVSRNRAPYIPLEPVAVLAGTEQVQNG |
| Ga0209168_1000187915 | 3300027986 | Surface Soil | FIKVFPHEFKRVLGVTRSEHAYIPSESLTALAAAEQVQHG |
| Ga0265338_108353421 | 3300028800 | Rhizosphere | WHEVNTRFIKVFPHEFKRVLGVTRSENAYIPGEPVGAMAQGEQVQHG |
| Ga0302197_102942621 | 3300028873 | Bog | TEALARFIKVFPHEHKRVLGMTRRQQPYIPGAALAVAAQSEQVSHG |
| Ga0308309_102751372 | 3300028906 | Soil | GEVLPRFIKVFPHEFKRVLGVSRNRAPYIPIAPIAVLAAAEQVQHG |
| Ga0222749_104666191 | 3300029636 | Soil | NWPEALSRFIKVFPHEHKRVLGVSRRRQPYIPSPALTAVAQAQQVQHG |
| Ga0311360_105417011 | 3300030339 | Bog | IKVFPREFKRVLGVSRSTQAYIPGQSLPSLAVEQVHHG |
| Ga0302183_102975941 | 3300030509 | Palsa | IKVFPHEHKRVLGVSRRRQPYIPAPPPAVLAAEQVQHG |
| Ga0311372_116791102 | 3300030520 | Palsa | RFIKVFPHEFKRVLGVSRNRAPYIPVDPIAVLAGAEQVQHG |
| Ga0170834_1065793542 | 3300031057 | Forest Soil | SRFIKVFPHEFKRVLGVRRSEQAYIPSQSDAILAHADQGQSEQVQHG |
| Ga0170824_1092180711 | 3300031231 | Forest Soil | HEFKRVLGVGRSQQAYIPSQPVSLLEPAEPLQHAQVQHG |
| Ga0170820_129535962 | 3300031446 | Forest Soil | SEAASRFIKVFPHEYKRVLGVGRRQQAYIPKPPVVVLAHAEPVPQQVQHG |
| Ga0170820_161689121 | 3300031446 | Forest Soil | MSRFIKVFPHEFKRVLGVGRSQQAYIPSQPVSLLEPAEPLQHAQVQHG |
| Ga0302320_107190231 | 3300031524 | Bog | LNNWKEALARFIKIFPHEHKRVLGMTRRRQPYIPSAVLAAAAQSEQVSHG |
| Ga0310686_1081068012 | 3300031708 | Soil | EALSRFIKVFPHEHKRVLGVSRRRQPYIPSAPLDTLVQAEQVQHG |
| Ga0265314_102426771 | 3300031711 | Rhizosphere | IKVFPHEHKRVLGVSRRRQPYIPSLPMAVLSPSQQVQHG |
| Ga0307477_111571632 | 3300031753 | Hardwood Forest Soil | IKVFPHEFKRVLGIARVEQAYIPGEPLAVLANAEQVQHG |
| Ga0307475_101017673 | 3300031754 | Hardwood Forest Soil | ARFIKIFPHEFKRVLGVSRSRQPYIPGQPVAVPELVEQVQHG |
| Ga0302319_113746722 | 3300031788 | Bog | PHEHKRVLGMTRRRQPYIPSAVLAAAAQSEQVSHG |
| Ga0318533_111867621 | 3300032059 | Soil | NRNEALVRFIKVFPHEYKRVLGVPRVEQAYIRGESVAVLANAEQVQHG |
| Ga0311301_110365331 | 3300032160 | Peatlands Soil | IKVFPHEHKRVLGVNRRHQHYIPSPSAVAMAPAEQVQHG |
| Ga0311301_123853542 | 3300032160 | Peatlands Soil | EMLSRFIKVFPHEFKRVLGAARSEQAYIPNQPAAVLAEAEQLQPEQVQHG |
| Ga0307471_1042652871 | 3300032180 | Hardwood Forest Soil | FPHEFKRVLGVGRSLQAYIPSQPVSLLEPAEPLLHAQVQHG |
| Ga0346503_10434321 | 3300033002 | Soil | IKVFPHEYKRVLGVERAAEAYIPAAAVRSLMPIEQVQHG |
| Ga0335077_102999103 | 3300033158 | Soil | VSRFIKVFPHEFKRVLGVSRSERAHVPGDSVAVLAAAEQVQHG |
| Ga0326726_101991153 | 3300033433 | Peat Soil | SELLPRFIKVFPHEYKRVLGVGRTAQPKIPEQVPLAVLAEQVQHG |
| ⦗Top⦘ |