Basic Information | |
---|---|
Family ID | F101678 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 41 residues |
Representative Sequence | RSTPVVPLEDGRRALALALDIVAAIREHGKKVGLAGMAKTKA |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.00 % |
% of genes near scaffold ends (potentially truncated) | 96.08 % |
% of genes from short scaffolds (< 2000 bps) | 86.27 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.529 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.490 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.804 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF13103 | TonB_2 | 10.78 |
PF13545 | HTH_Crp_2 | 1.96 |
PF02900 | LigB | 1.96 |
PF00072 | Response_reg | 0.98 |
PF16320 | Ribosomal_L12_N | 0.98 |
PF12706 | Lactamase_B_2 | 0.98 |
PF04342 | DMT_6 | 0.98 |
PF01431 | Peptidase_M13 | 0.98 |
PF12681 | Glyoxalase_2 | 0.98 |
PF00903 | Glyoxalase | 0.98 |
PF01745 | IPT | 0.98 |
PF01288 | HPPK | 0.98 |
PF00069 | Pkinase | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.92 |
COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.98 |
COG3169 | Uncharacterized membrane protein, DMT/DUF486 family | Function unknown [S] | 0.98 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.53 % |
Unclassified | root | N/A | 26.47 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000574|JGI1357J11328_10165082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 617 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101127221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
3300003368|JGI26340J50214_10000697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11434 | Open in IMG/M |
3300004092|Ga0062389_101209953 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300005180|Ga0066685_11046132 | Not Available | 537 | Open in IMG/M |
3300005436|Ga0070713_100062182 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
3300005437|Ga0070710_11068945 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005439|Ga0070711_100081299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2309 | Open in IMG/M |
3300005534|Ga0070735_10052374 | All Organisms → cellular organisms → Bacteria | 2695 | Open in IMG/M |
3300005534|Ga0070735_10391527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
3300005538|Ga0070731_10851272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
3300005542|Ga0070732_11001834 | Not Available | 511 | Open in IMG/M |
3300005602|Ga0070762_10109968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1606 | Open in IMG/M |
3300005602|Ga0070762_10492771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
3300005602|Ga0070762_11144638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus saanensis | 537 | Open in IMG/M |
3300005610|Ga0070763_10292481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300005876|Ga0075300_1044330 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300006028|Ga0070717_10749818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 888 | Open in IMG/M |
3300006050|Ga0075028_100715068 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300006162|Ga0075030_100163482 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
3300006174|Ga0075014_100600604 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300006176|Ga0070765_100951024 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300006176|Ga0070765_101753631 | Not Available | 583 | Open in IMG/M |
3300006854|Ga0075425_102207769 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300009520|Ga0116214_1110674 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300009616|Ga0116111_1056613 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300010366|Ga0126379_10759656 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300010379|Ga0136449_100185368 | All Organisms → cellular organisms → Bacteria | 3993 | Open in IMG/M |
3300011269|Ga0137392_11411815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300012917|Ga0137395_10916109 | Not Available | 633 | Open in IMG/M |
3300012927|Ga0137416_10310984 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300012984|Ga0164309_11842241 | Not Available | 519 | Open in IMG/M |
3300014654|Ga0181525_10795407 | Not Available | 534 | Open in IMG/M |
3300014658|Ga0181519_10840067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 568 | Open in IMG/M |
3300016357|Ga0182032_10358088 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300017930|Ga0187825_10352007 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300017936|Ga0187821_10021636 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
3300017943|Ga0187819_10821013 | Not Available | 522 | Open in IMG/M |
3300017946|Ga0187879_10332275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 843 | Open in IMG/M |
3300017975|Ga0187782_11373808 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300017975|Ga0187782_11650479 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300018006|Ga0187804_10019487 | All Organisms → cellular organisms → Bacteria | 2452 | Open in IMG/M |
3300018040|Ga0187862_10289046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
3300018043|Ga0187887_10252624 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300018062|Ga0187784_10349544 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300018086|Ga0187769_11431365 | Not Available | 523 | Open in IMG/M |
3300018090|Ga0187770_10967496 | Not Available | 684 | Open in IMG/M |
3300018431|Ga0066655_10275630 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
3300020581|Ga0210399_11545030 | Not Available | 513 | Open in IMG/M |
3300020582|Ga0210395_10376139 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300020582|Ga0210395_11125138 | Not Available | 579 | Open in IMG/M |
3300021168|Ga0210406_10194531 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
3300021170|Ga0210400_10567239 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300021170|Ga0210400_10646046 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300021181|Ga0210388_10977327 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300021181|Ga0210388_11610797 | Not Available | 539 | Open in IMG/M |
3300021402|Ga0210385_10125461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1816 | Open in IMG/M |
3300021402|Ga0210385_10907929 | Not Available | 676 | Open in IMG/M |
3300021407|Ga0210383_10969615 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300021420|Ga0210394_10651611 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300021445|Ga0182009_10019674 | All Organisms → cellular organisms → Bacteria | 2534 | Open in IMG/M |
3300021559|Ga0210409_10341321 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
3300021559|Ga0210409_10447698 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300022508|Ga0222728_1016691 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300022732|Ga0224569_103572 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300025404|Ga0208936_1013049 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300026329|Ga0209375_1286208 | Not Available | 540 | Open in IMG/M |
3300027072|Ga0208238_1025531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300027109|Ga0208603_1054454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 606 | Open in IMG/M |
3300027168|Ga0208239_1025969 | Not Available | 571 | Open in IMG/M |
3300027537|Ga0209419_1083508 | Not Available | 632 | Open in IMG/M |
3300027648|Ga0209420_1012424 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
3300027648|Ga0209420_1214708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
3300027676|Ga0209333_1101974 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300027825|Ga0209039_10301281 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300027855|Ga0209693_10485101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300027862|Ga0209701_10124480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1594 | Open in IMG/M |
3300027869|Ga0209579_10132609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1325 | Open in IMG/M |
3300027898|Ga0209067_10579478 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300027903|Ga0209488_10650486 | Not Available | 760 | Open in IMG/M |
3300027911|Ga0209698_10112216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2269 | Open in IMG/M |
3300028565|Ga0302145_10304995 | Not Available | 526 | Open in IMG/M |
3300028731|Ga0302301_1167918 | Not Available | 540 | Open in IMG/M |
3300028906|Ga0308309_11483624 | Not Available | 580 | Open in IMG/M |
3300029636|Ga0222749_10500597 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300029882|Ga0311368_10028153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5365 | Open in IMG/M |
3300029944|Ga0311352_11063315 | Not Available | 620 | Open in IMG/M |
3300030056|Ga0302181_10138907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1169 | Open in IMG/M |
3300030519|Ga0302193_10299925 | Not Available | 847 | Open in IMG/M |
3300030740|Ga0265460_13090750 | Not Available | 501 | Open in IMG/M |
3300031231|Ga0170824_120911820 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300031233|Ga0302307_10019347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3830 | Open in IMG/M |
3300031247|Ga0265340_10557253 | Not Available | 504 | Open in IMG/M |
3300031754|Ga0307475_10141333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1907 | Open in IMG/M |
3300031823|Ga0307478_10472161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1044 | Open in IMG/M |
3300032180|Ga0307471_100989142 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300032180|Ga0307471_103736739 | Not Available | 538 | Open in IMG/M |
3300032515|Ga0348332_13685329 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300032898|Ga0335072_11049369 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300034282|Ga0370492_0107882 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.67% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.84% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.90% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.90% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.90% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.90% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.94% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.96% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.96% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.98% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.98% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1357J11328_101650822 | 3300000574 | Groundwater | RSKPVVPLEDGRRALAVALDILAQIREHGRRINLEGIVRQ* |
JGIcombinedJ26739_1011272212 | 3300002245 | Forest Soil | VPLEDGRRALALALDVVGAIREHGKKVGLAGIAKAKG* |
JGI26340J50214_1000069715 | 3300003368 | Bog Forest Soil | RSQPVVPLEDGRRALALALEIVAAIREHGKRVDLAGLAKTKH* |
Ga0062389_1012099532 | 3300004092 | Bog Forest Soil | VPLEDGRRALALALDLVAEIGKHGTKVGLTGIAFSKPTL* |
Ga0066673_100123751 | 3300005175 | Soil | VRTRSSAAVPLEDGRRALAVALKILEAIGEHSRNVNLEKLR* |
Ga0066685_110461322 | 3300005180 | Soil | QRSTPVVSLEDGKRALGLALEIVGAIRAHGTKVGLAGMATVRQ* |
Ga0070713_1000621825 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VRERSTPVVSLEEGRRALALALEILAAVREHAKKVGLARA* |
Ga0070710_110689451 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PVVPLEDGRRALALALEIVAAIRDHGAKVDLAGIASSKL* |
Ga0070711_1000812993 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LQAVRDRSTPVVPLDDGRHALALALEIVSAIRDHGNKVGLAGMAKS* |
Ga0070735_100523741 | 3300005534 | Surface Soil | SKPVVPVEEGRRALALALDIVAAIREHGKRVGLAGMAKVKS* |
Ga0070735_103915271 | 3300005534 | Surface Soil | SKPVVPVEEGRRALALALDIVAAIREHGKRVGLAGMAKVKG* |
Ga0070731_108512723 | 3300005538 | Surface Soil | VSIEDGRRALALALDIVGAIRDHGKKVGLAGLAGNKS* |
Ga0070732_110018343 | 3300005542 | Surface Soil | AVRQRSTAAVPLEDGRRALALALDIVQAIREHGKKIDLAGIAEGRH* |
Ga0066705_107645711 | 3300005569 | Soil | QQPIVPLEDGRRALAVALDILGRIREHGRRLNLEKLR* |
Ga0070762_101099682 | 3300005602 | Soil | VRERSEPEVPLEDGRRALALALEIVAAIREHGKKVDLAGIAKKTKH* |
Ga0070762_104927711 | 3300005602 | Soil | LEDGRRALALALDVVGAIREHGKKVGLAGIAKAKG* |
Ga0070762_111446381 | 3300005602 | Soil | PLVPLAEGRRALALALEIVAAIREHGKRVGLSGIAKKQP* |
Ga0070763_102924812 | 3300005610 | Soil | STPVVPLEDGRRALALALDVVGAIREHGKKVGLAGIAKAKG* |
Ga0075300_10443302 | 3300005876 | Rice Paddy Soil | RERSAPVVPLEDGRRALALALEIVAGIREHGNKVGLAAINPNKH* |
Ga0070717_107498182 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | KSFLRAVRQRSTPIVSLEDGKRALGLALEIVAAIRAHGTKVGLAGMATVRQ* |
Ga0075028_1007150682 | 3300006050 | Watersheds | STPIVPLEDGRRALALALEIISAIRDHGAKVDLAGMTSGKH* |
Ga0075030_1001634821 | 3300006162 | Watersheds | VRERSTPVVPLEDGRRALALALEIVSAIREHDKRLDVAGIAKP* |
Ga0075014_1006006041 | 3300006174 | Watersheds | VPLEDGRRALALALEIISAIRDHGKKIDLAGIAKVKN* |
Ga0070765_1009510243 | 3300006176 | Soil | ERSAPVVPLEDGRRALALAFEIVAAIRDHGRKVDVAGMARS* |
Ga0070765_1017536312 | 3300006176 | Soil | AVRERSTPVVPIGDGRRALALALDIVETIREHGNKVGLAGLTKAKG* |
Ga0075425_1022077693 | 3300006854 | Populus Rhizosphere | SLEDGRRALALALEIVGAIREHAKKVGLVGAAKAKG* |
Ga0116214_11106742 | 3300009520 | Peatlands Soil | VRQRSTPVVPLEDGRRSLALALDIVAEIREHGKKVDLAGIAKATH* |
Ga0116111_10566131 | 3300009616 | Peatland | PLEDGRRALALALEIVAAIRDHGKKVGLPGIADAKH* |
Ga0126379_107596561 | 3300010366 | Tropical Forest Soil | HAVWNRSTPLVPLEDGRRALALALEIVTAIREHGSKVGLRSMAGH* |
Ga0136449_1001853684 | 3300010379 | Peatlands Soil | VVPLEDGRRALALALEIVSAIREHGANVGLAGIAHARP* |
Ga0137392_114118151 | 3300011269 | Vadose Zone Soil | QRSAPLVPLEDGRRELALALDIVAAIREHGTKVGLAGIAKAKV* |
Ga0137395_109161091 | 3300012917 | Vadose Zone Soil | STPVVPLEDGRRSLALAFDIVDAIRDHGRKVGVSGMGKAKG* |
Ga0137416_103109841 | 3300012927 | Vadose Zone Soil | NRSASLVPLEDGRRALALALDIVSAIRDHGKKVDLATLAKTPN* |
Ga0164309_118422411 | 3300012984 | Soil | TPVVPLEDGRRALALALEIVAAIRERGAKVGHAGLAKS* |
Ga0181525_107954072 | 3300014654 | Bog | VRERSTPVVPLSDGRRSLALALEIVAAIREHGSKVGLTDLAQLKI* |
Ga0181519_108400672 | 3300014658 | Bog | STPVVSLEDGRRALALALEIVAAVGEHGSKVGIGDLAKPKA* |
Ga0182032_103580881 | 3300016357 | Soil | RHRSTPVVPLEDGHRALALALEILAGIREHSKKVGLGKS |
Ga0187825_103520071 | 3300017930 | Freshwater Sediment | SEPVVPLEDGRRALALALEIVAGIREHGKKVGLAGIAKG |
Ga0187821_100216361 | 3300017936 | Freshwater Sediment | ERTTPVVSLDEGRRALALALEIVAAIRAHGKKIDVAAMVRS |
Ga0187819_108210131 | 3300017943 | Freshwater Sediment | RSTPVVPLEDGRRALALALDIVAAIREHGKNVGLAGLAKAKG |
Ga0187879_103322753 | 3300017946 | Peatland | VSLDDGHRALALALEILAAIREHGKKVGLAGLAKAKV |
Ga0187782_113738082 | 3300017975 | Tropical Peatland | SAVPLEDGRRALDLALQIVAAIGEHGKKIDLPSIAKMR |
Ga0187782_116504791 | 3300017975 | Tropical Peatland | VPLEDGRRALALALEIVSAIREHGKRIDLASMTRAGR |
Ga0187804_100194873 | 3300018006 | Freshwater Sediment | SLEDGRRALGLALEIVAAIREHGNKVGLVGMAKAKS |
Ga0187862_102890461 | 3300018040 | Peatland | PVVPLEDGRRALGLALEIVGAIRDHGKKVDLAGMGKAKY |
Ga0187887_102526242 | 3300018043 | Peatland | VPLEDGRRALALALEIVAAIREHGKKVDLAGIARKKH |
Ga0187784_103495442 | 3300018062 | Tropical Peatland | VRQRSTPEVPLEDGRRALALALEIVAAIREHGKNIDLAGIART |
Ga0187769_114313652 | 3300018086 | Tropical Peatland | AVRERTKPVVSLEEGRNALKLALEILSEIRRHAGRVGMAGD |
Ga0187770_109674961 | 3300018090 | Tropical Peatland | TPVVSLDDGRRALALALDIVAAIRDHSKRIDLAGIAKRN |
Ga0066655_102756301 | 3300018431 | Grasslands Soil | FTPWVSLEDGRSALGLALDNVAAMREHGNKVGLAAIGHTKQ |
Ga0210399_115450301 | 3300020581 | Soil | RERSAPDVPLEDGRRSLALALEIVAAIREHGKKVDLAGITTAKD |
Ga0210395_103761393 | 3300020582 | Soil | PEVPLEDGRRALALALEIVAAIREHGKKVDLAVIAKKKH |
Ga0210395_111251381 | 3300020582 | Soil | SLEDGHRALALALEIVSAIRDHGKKIDLAGLAKGKR |
Ga0210406_101945312 | 3300021168 | Soil | VVPLEDGRRALALALEVVAAIREHGKRVDLAGIAKAKH |
Ga0210400_105672391 | 3300021170 | Soil | APAVSLEDGRRALALALDIVAAIGDHGKKVDLPTIAGATR |
Ga0210400_106460461 | 3300021170 | Soil | PPAVSLEDGRRALALALDIVAAIGDHGKKVDLPTIAGATR |
Ga0210388_109773271 | 3300021181 | Soil | PVVPLEDGRRALALALEIVSAIREHGAKVGLAGIGHARH |
Ga0210388_116107971 | 3300021181 | Soil | STPVVPLSDGRRALALALDIVAAIREHGKRVGLAGLAKT |
Ga0210385_101254611 | 3300021402 | Soil | SEPEVPLKDGLRSLALALDIVAAIRAHGQNVNLASIAK |
Ga0210385_109079291 | 3300021402 | Soil | VPLEDGRRALALALEIVAAIREHGKKVDLAGIAKKTKH |
Ga0210383_109696152 | 3300021407 | Soil | SAPDVPLEDGRRSLALALEIVAAIREHGKKLDLAGIATAKH |
Ga0210394_106516112 | 3300021420 | Soil | TPVVPLEDGRRALALALEIVDAIRDHGTKVNLAGIAKAKP |
Ga0182009_100196741 | 3300021445 | Soil | PVVPLEDGRRALALALEIVASIREHGNKVGLAEINHSKK |
Ga0210409_103413212 | 3300021559 | Soil | RFMPLVPLAEGRRALALALEIVAAIREHGKRVGLSGIAKKQP |
Ga0210409_104476982 | 3300021559 | Soil | VVPLEDGRRALALALEIVDAIRDHGKKVGLAGIAKAKH |
Ga0222728_10166912 | 3300022508 | Soil | RSFLHAVRQRSTPVVPLDDGRRALSLALDIVGAIREHGKKVGLAGIAKTKS |
Ga0224569_1035722 | 3300022732 | Rhizosphere | QRSAPVVPIDDGRRALALALDIVSAIREHGKKVGLAGLARAKG |
Ga0208936_10130492 | 3300025404 | Peatland | RERSTPVVPLKDGRRALALALDIVAAIREHGKKVGLAGMAKTKA |
Ga0209375_12862082 | 3300026329 | Soil | NAVRHRSAPAVSLEDGRRALALALDIVAAIRDHGKKVDLPTIAGATR |
Ga0208238_10255311 | 3300027072 | Forest Soil | LHAVRQRSTPLVPLDHGRRALALALEIVDAIRQHGNKVGLADLANAKG |
Ga0208603_10544542 | 3300027109 | Forest Soil | TPVVPLEDGRRALALALDIVAAIRAHGKKVGLGTLAKAKG |
Ga0208239_10259691 | 3300027168 | Forest Soil | RPEVPLEDGRRALALALEIVAAIRDHGKKVDLAGIGKTEH |
Ga0209419_10835082 | 3300027537 | Forest Soil | PVVSLEDGRRALGLALEILGAIRDHGKKVGLAGIAKSKH |
Ga0209420_10124241 | 3300027648 | Forest Soil | VVPLEDGRRALALALDIVAAIREHGKKVGLAGIARAKV |
Ga0209420_12147082 | 3300027648 | Forest Soil | AVRQRSTPLVPLDHGRRALALALEIVDAIRQHGNKVGLADLANAKG |
Ga0209333_11019741 | 3300027676 | Forest Soil | LEDGRRALALALEIVDAIRDHGTKVNLAGIAKAKP |
Ga0209039_103012812 | 3300027825 | Bog Forest Soil | SVPMVPLDEGRRSLALALDIVAVIAEHGKKVGLGRLAKSQP |
Ga0209693_104851011 | 3300027855 | Soil | RSTPVVPLEDGRRALALALDVVGAIREHGKKVGLAGIAKAKG |
Ga0209701_101244801 | 3300027862 | Vadose Zone Soil | QRATPDVPLEDGRRALALALDIVAAIRDHGKKVGLSGLAKAKG |
Ga0209579_101326091 | 3300027869 | Surface Soil | RERSTPVVPLEDGRRALALALEIVAAIREHGKKVDLAGIVGSKH |
Ga0209067_105794781 | 3300027898 | Watersheds | LKSFLHAVRERSTPVVPLEDGCRALALALEIVSAIRDHGKKVDLAGIAKVKS |
Ga0209488_106504862 | 3300027903 | Vadose Zone Soil | VRQRSTPVVPLEDGRRSLALAFDIVDAIREHGKKVGVAGMAKTKR |
Ga0209698_101122163 | 3300027911 | Watersheds | VRERSTPVVPLEDGRRALALALEIVSAIREHDKRLDVAGIAKP |
Ga0302145_103049951 | 3300028565 | Bog | ERSTPVVPLKDGRRALALALDIVAAIREHGKKVGLAGMAKTKA |
Ga0302301_11679181 | 3300028731 | Palsa | STPVVPLDDGRRALALALEIVAAIREHARKIDLAVMA |
Ga0308309_114836241 | 3300028906 | Soil | SLEDGHRALALALEIVSAIRDHGKKIDLAGIAKGKR |
Ga0222749_105005971 | 3300029636 | Soil | VVPLADGRRALALALDIVAAIGEHGKKIGLSAIAKSKN |
Ga0311368_100281538 | 3300029882 | Palsa | RSTPVVPLEDGRRALALALDIVAAIREHGKKVGLAGMAKTKA |
Ga0311352_110633151 | 3300029944 | Palsa | ERSTPVVPLDDGRRALALALEIVAAIREHARKIDLAVMA |
Ga0302181_101389071 | 3300030056 | Palsa | LEDGRRSLALALDIVGAIREHGKKVGLAGLAKAKR |
Ga0302193_102999251 | 3300030519 | Bog | LEDGRRALALALDIVGAIREHGKKVGLAGLAKVKG |
Ga0265460_130907501 | 3300030740 | Soil | VVPLEDGRRALALALDIVAEIREHGKKVGLAGIAKAKG |
Ga0170824_1209118202 | 3300031231 | Forest Soil | VPLEDGLRALALALEIVAAIREHGKKVDLAGIANARP |
Ga0302307_100193474 | 3300031233 | Palsa | ERSTPLVPLEDGQRALALALEIVAAIRDHGKKVDLAGIAKTGH |
Ga0265340_105572531 | 3300031247 | Rhizosphere | RSTPVVPLEDGRRALALALEVVAAIREHGKKVDLAGIAKSKD |
Ga0307475_101413333 | 3300031754 | Hardwood Forest Soil | PLVPLEDGRRALALALDIVAAIRQHGQSVNLAGIATA |
Ga0307478_104721611 | 3300031823 | Hardwood Forest Soil | PVVPLEDGRRALALALEIVQAIREHGKKVGLAGLAKAKG |
Ga0307471_1009891421 | 3300032180 | Hardwood Forest Soil | RSTPIVSLEDGKRALGLALEIVAAIRAHGTKVGLAGMATVRQ |
Ga0307471_1037367391 | 3300032180 | Hardwood Forest Soil | VPLEDGLRALALALEIVAAIREHGKKVDLAGIAKARH |
Ga0348332_136853292 | 3300032515 | Plant Litter | SAPVVPIDDGRRALALALDIVGAIREHGKKVGLAGLARAKG |
Ga0335072_110493692 | 3300032898 | Soil | RGRSKPAVPVEEGRRALELAFDIVAAIRQHGKKVGLAGMAKRG |
Ga0370492_0107882_961_1077 | 3300034282 | Untreated Peat Soil | VVPLEDGQRALALALEIVAAIREHGNRAGLADLAKLKT |
⦗Top⦘ |