Basic Information | |
---|---|
Family ID | F101671 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 42 residues |
Representative Sequence | KGTEKGKPYVHRERFVDTWIKLNGTWQCVATTSTLITAK |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 96.08 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.157 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.647 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.451 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 47.76% Coil/Unstructured: 52.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF00106 | adh_short | 12.75 |
PF01263 | Aldose_epim | 9.80 |
PF14534 | DUF4440 | 6.86 |
PF07963 | N_methyl | 3.92 |
PF11154 | DUF2934 | 2.94 |
PF00589 | Phage_integrase | 2.94 |
PF13852 | DUF4197 | 2.94 |
PF13414 | TPR_11 | 0.98 |
PF07519 | Tannase | 0.98 |
PF12215 | Glyco_hydr_116N | 0.98 |
PF01011 | PQQ | 0.98 |
PF05336 | rhaM | 0.98 |
PF13533 | Biotin_lipoyl_2 | 0.98 |
PF13374 | TPR_10 | 0.98 |
PF07690 | MFS_1 | 0.98 |
PF14517 | Tachylectin | 0.98 |
PF00326 | Peptidase_S9 | 0.98 |
PF01288 | HPPK | 0.98 |
PF03069 | FmdA_AmdA | 0.98 |
PF02129 | Peptidase_S15 | 0.98 |
PF13431 | TPR_17 | 0.98 |
PF13302 | Acetyltransf_3 | 0.98 |
PF13545 | HTH_Crp_2 | 0.98 |
PF11138 | DUF2911 | 0.98 |
PF00578 | AhpC-TSA | 0.98 |
PF01041 | DegT_DnrJ_EryC1 | 0.98 |
PF04055 | Radical_SAM | 0.98 |
PF13561 | adh_short_C2 | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0676 | D-hexose-6-phosphate mutarotase | Carbohydrate transport and metabolism [G] | 9.80 |
COG2017 | Galactose mutarotase or related enzyme | Carbohydrate transport and metabolism [G] | 9.80 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.98 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.98 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.98 |
COG0801 | 7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase (folate biosynthesis) | Coenzyme transport and metabolism [H] | 0.98 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.98 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.98 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.98 |
COG3254 | L-rhamnose mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.16 % |
Unclassified | root | N/A | 7.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig85404 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
2189573000|GPBTN7E01AZAFG | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Dictyobacteraceae → Dictyobacter | 515 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100690149 | Not Available | 899 | Open in IMG/M |
3300004479|Ga0062595_100718895 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300005181|Ga0066678_10065788 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
3300005187|Ga0066675_10281121 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300005537|Ga0070730_10539959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella | 747 | Open in IMG/M |
3300005545|Ga0070695_101440197 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300005555|Ga0066692_10738512 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300005841|Ga0068863_102719076 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005995|Ga0066790_10149955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 998 | Open in IMG/M |
3300006046|Ga0066652_101405464 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300006174|Ga0075014_100767114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
3300006852|Ga0075433_10641661 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300006881|Ga0068865_101038537 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300009137|Ga0066709_101427884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300009162|Ga0075423_13096682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300009553|Ga0105249_11684199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
3300009683|Ga0116224_10253837 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300010046|Ga0126384_11940599 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300010048|Ga0126373_10928571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
3300010360|Ga0126372_11176728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
3300010361|Ga0126378_10652554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
3300010376|Ga0126381_102115014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
3300010376|Ga0126381_103683672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300010376|Ga0126381_104172953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300010876|Ga0126361_10306030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300011269|Ga0137392_10217444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1567 | Open in IMG/M |
3300011270|Ga0137391_11172855 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300012201|Ga0137365_10030491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4148 | Open in IMG/M |
3300012205|Ga0137362_10714893 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300012362|Ga0137361_10518363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
3300012362|Ga0137361_11821354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300012363|Ga0137390_11114698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300012582|Ga0137358_10574085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
3300012582|Ga0137358_10937632 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300012685|Ga0137397_10898843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300012927|Ga0137416_11141515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300012927|Ga0137416_12211138 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300012929|Ga0137404_11248894 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300012929|Ga0137404_12088832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300012930|Ga0137407_11691420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300012930|Ga0137407_12062929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300012971|Ga0126369_11865549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
3300012986|Ga0164304_11581916 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300016319|Ga0182033_10297350 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300016387|Ga0182040_11168710 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300016404|Ga0182037_11282749 | Not Available | 645 | Open in IMG/M |
3300017822|Ga0187802_10394542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300017933|Ga0187801_10169171 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300017966|Ga0187776_10627804 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300017995|Ga0187816_10156912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300018012|Ga0187810_10166400 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
3300018012|Ga0187810_10443571 | Not Available | 549 | Open in IMG/M |
3300018058|Ga0187766_11124534 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300018089|Ga0187774_11034004 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300019886|Ga0193727_1130724 | Not Available | 707 | Open in IMG/M |
3300019887|Ga0193729_1123772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
3300020034|Ga0193753_10001561 | All Organisms → cellular organisms → Bacteria | 19377 | Open in IMG/M |
3300020199|Ga0179592_10170297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
3300020199|Ga0179592_10461567 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300020579|Ga0210407_10184867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1616 | Open in IMG/M |
3300020579|Ga0210407_10744591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
3300021168|Ga0210406_10427573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
3300021178|Ga0210408_10136892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1936 | Open in IMG/M |
3300021178|Ga0210408_10145177 | All Organisms → cellular organisms → Bacteria | 1878 | Open in IMG/M |
3300021477|Ga0210398_10300988 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300021559|Ga0210409_10049225 | All Organisms → cellular organisms → Bacteria | 3968 | Open in IMG/M |
3300021559|Ga0210409_10209730 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
3300024179|Ga0247695_1006975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1609 | Open in IMG/M |
3300024246|Ga0247680_1020820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 951 | Open in IMG/M |
3300025915|Ga0207693_11046414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300026326|Ga0209801_1325127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Scytonemataceae → Brasilonema → Brasilonema sennae → Brasilonema sennae CENA114 | 543 | Open in IMG/M |
3300026467|Ga0257154_1023659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
3300026529|Ga0209806_1268153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300026895|Ga0207758_1007405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1174 | Open in IMG/M |
3300026981|Ga0207822_1025321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
3300027071|Ga0209214_1014899 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300027663|Ga0208990_1129734 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300027853|Ga0209274_10104254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1401 | Open in IMG/M |
3300027884|Ga0209275_10051262 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
3300028792|Ga0307504_10424319 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300028873|Ga0302197_10140515 | Not Available | 1172 | Open in IMG/M |
3300029951|Ga0311371_10850259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1113 | Open in IMG/M |
3300030494|Ga0310037_10415598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
3300030687|Ga0302309_10363033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300031231|Ga0170824_100547363 | Not Available | 647 | Open in IMG/M |
3300031718|Ga0307474_10512921 | Not Available | 941 | Open in IMG/M |
3300031754|Ga0307475_10336745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
3300031821|Ga0318567_10803091 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300031879|Ga0306919_10114831 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
3300031941|Ga0310912_10872397 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300031941|Ga0310912_10994639 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300031942|Ga0310916_10646365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
3300032052|Ga0318506_10519586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300032064|Ga0318510_10263991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
3300032076|Ga0306924_12527278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
3300032174|Ga0307470_10149535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1426 | Open in IMG/M |
3300032180|Ga0307471_103609150 | Not Available | 548 | Open in IMG/M |
3300032782|Ga0335082_10953875 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300032828|Ga0335080_11197530 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300032829|Ga0335070_12075296 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.90% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.94% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.98% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026895 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes) | Environmental | Open in IMG/M |
3300026981 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 67 (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030687 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0404.00005580 | 2166559005 | Simulated | HTKKGKPYVHRERFTDTWIKHDQTWQCVASHATLIPSK |
N55_03473490 | 2189573000 | Grass Soil | KGKPYVHRERFTDTWIKHDQSWQCVASHATLIPSK |
JGIcombinedJ26739_1006901491 | 3300002245 | Forest Soil | IFRVKGVEKGKPYVHRERFVDTWIKTNGTWQCVATTGTLITAKQQPAD* |
Ga0062595_1007188952 | 3300004479 | Soil | GKEKGKPYVRRERFADTWIKIHGTWQCVATTSTLIAAKHVAD* |
Ga0066678_100657881 | 3300005181 | Soil | RVKGMEKGKPYVHRERFIDTWIKQSQTWQCVASSATLISAK* |
Ga0066675_102811211 | 3300005187 | Soil | VVVGIFRIKGMEKGKPYVHRERFTDTWIKVDQGWQCVASQATLIAAK* |
Ga0070730_105399591 | 3300005537 | Surface Soil | GIFRVKGVEKGKPYVHRERFIDTWIKRDQGWQCVASSATLITAK* |
Ga0070695_1014401971 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VVGVFRVKGKEKGKPYVRRERFADTWIKIHGTWQCVATTSTLIAAKQAAD* |
Ga0066692_107385122 | 3300005555 | Soil | AVVVGIFRVKGMEKGKPYVHRERFIDTWIKQSQTWQCVASSATLISAK* |
Ga0068863_1027190762 | 3300005841 | Switchgrass Rhizosphere | GIEKGKPYVHRERFIDTWIKQNQTWQCVASSATLITTK* |
Ga0066790_101499551 | 3300005995 | Soil | KGKSYVHRERFVDTWVKMNGTWQCVATTAALIPAKQAAD* |
Ga0066652_1014054642 | 3300006046 | Soil | VSGIFRVKGVEKGKPYVHRERFIDTWIKQDQTWQCVASSATLISAK* |
Ga0075014_1007671141 | 3300006174 | Watersheds | VVGIFRTKGTDNGKTYTRRERFVDTWIKTNGSWQCVATTSALIPSKQAAD* |
Ga0075433_106416611 | 3300006852 | Populus Rhizosphere | GKPYVHRERFIDTWIKQNQGWQCVASSATLITAK* |
Ga0068865_1010385371 | 3300006881 | Miscanthus Rhizosphere | EKGKPYVRRERFADTWIKIHGTWQCVATTSTLIAAKQAAD* |
Ga0066709_1014278842 | 3300009137 | Grasslands Soil | GVEKGKPYVHRERFIDTWIKQDQTWQCVASSATLISAK* |
Ga0075423_130966821 | 3300009162 | Populus Rhizosphere | KGKPYVHRERFIDTWIKRGQGWQCVASSATLITAK* |
Ga0105249_116841991 | 3300009553 | Switchgrass Rhizosphere | VVGIFRIKGVEKGKSYVRRERFIDTWIKQNQGWQCVASAATSITTK* |
Ga0116224_102538372 | 3300009683 | Peatlands Soil | AVVVGVFRVKGTEKGKAYLHRERFVDTWIKINGTWQCVATTSTLMTAK* |
Ga0126384_119405991 | 3300010046 | Tropical Forest Soil | EKGKPYVHRERFIDTWIKQNQSWQCVASSATLITAK* |
Ga0126373_109285711 | 3300010048 | Tropical Forest Soil | KGTDRGKPFVHRERFVDTWIKSNRAWQCVATTSTLITAKQAD* |
Ga0126372_111767282 | 3300010360 | Tropical Forest Soil | KGVEKGKPYVHRERFIDTWIRRDGGWQCVASAATLITAK* |
Ga0126378_106525541 | 3300010361 | Tropical Forest Soil | KGKPYVHRERFVDTWVKISGRWQCVATTSALITGKQPAD* |
Ga0126381_1021150142 | 3300010376 | Tropical Forest Soil | KGTDKGKPFVHRERFVDTWIKSNRAWQCVATTSTLITAKQAD* |
Ga0126381_1036836721 | 3300010376 | Tropical Forest Soil | KGMEKGKPYVHRERFIDTWIKQNQGWQCVASSATLITTK* |
Ga0126381_1041729531 | 3300010376 | Tropical Forest Soil | GMEKGKPYVHRERFIDTWIKQNQGWQCVASSATLITTK* |
Ga0126361_103060301 | 3300010876 | Boreal Forest Soil | RIKGMEKGKSYARRERFVDTWIKINGAWQCVATTSTLITAK* |
Ga0137392_102174443 | 3300011269 | Vadose Zone Soil | TEKGKPYVHRERFVDTWIKLNGTWQCVATTGTLITAKPGAN* |
Ga0137391_111728551 | 3300011270 | Vadose Zone Soil | GTEKGKPYVHRERFVDTWIKINGTWQCVATTGTLITAKPGAN* |
Ga0137365_100304914 | 3300012201 | Vadose Zone Soil | AVVVGIFRVKGTEKGKPYVHRERFVDTWIKVNGTWQCVATTSTLISTKQAAD* |
Ga0137362_107148931 | 3300012205 | Vadose Zone Soil | KGTENGKPYVRRERFTDMWIKINEAWQCVASQTTLIPPK* |
Ga0137361_105183633 | 3300012362 | Vadose Zone Soil | VGVFRIKGTEKGKPYVHRERFLDTWIKVRGTWQCVATTSTLITAK* |
Ga0137361_118213541 | 3300012362 | Vadose Zone Soil | AAVVVGVFRIKGTEKGKPYVRRERFVDTWIKLHGTWQCVATTSTLIAAK* |
Ga0137390_111146981 | 3300012363 | Vadose Zone Soil | VVGTFRVKGTEKGKPYVHRERFVDTWIKMNGTWQCVATTGTLITPK* |
Ga0137358_105740852 | 3300012582 | Vadose Zone Soil | DVAVVVGVFRIKGTEKGKPYVRRERFVDTWIKLHGTWQCVATTSTLIAAK* |
Ga0137358_109376322 | 3300012582 | Vadose Zone Soil | ENGKPYVRRERFTDMWIKINEAWQCVASQTTLIPSK* |
Ga0137397_108988431 | 3300012685 | Vadose Zone Soil | IKGTEKGKPYVHRERFVDTWIKVRGTRQCVATTSTLITAK* |
Ga0137416_111415151 | 3300012927 | Vadose Zone Soil | TENNKPYTRRERFTDTWIKFNQTWQCVASQTTLIPSK* |
Ga0137416_122111382 | 3300012927 | Vadose Zone Soil | VGTFRVKGTEKGKPYVHRERFVDTWIKINGTWQCVATTGTLITAKPGAN* |
Ga0137404_112488942 | 3300012929 | Vadose Zone Soil | VVVGVFRIKGTEKGKPYVRRERFLDTWIKVRGTWQCVATTSTLITAK* |
Ga0137404_120888321 | 3300012929 | Vadose Zone Soil | VGVFRIKGTEKGKPYVRRERFLDTWIKFHGTWQCVATTSTLITAK* |
Ga0137407_116914202 | 3300012930 | Vadose Zone Soil | EKGKPYVRRERFVDTWIKLHGTWQCVATTSTLIAAK* |
Ga0137407_120629291 | 3300012930 | Vadose Zone Soil | GKPYVHRERFTDTWIKYDQTWKCVASQATLIAAK* |
Ga0126369_118655491 | 3300012971 | Tropical Forest Soil | IKGVEKGKPYVHRERFIDTWIRQNQGWQCVASSATLITGK* |
Ga0164304_115819162 | 3300012986 | Soil | TFRVRGTENGKPYARRERFTDTWIKINEAWQCVASQATLIPPK* |
Ga0182033_102973503 | 3300016319 | Soil | IFRVKGTEKGKSYVHRERFIDTWIKHDRSWQCVASSATLITTK |
Ga0182040_111687101 | 3300016387 | Soil | IKGTDKGKAFSHRERFVDTWVESNGAWQCVATTSNLIATRPAGEPATQP |
Ga0182037_112827492 | 3300016404 | Soil | SYVHRERFVDTWIKINGTWQCVATTAALIPAKQPAD |
Ga0187802_103945422 | 3300017822 | Freshwater Sediment | VKGVEKGKAFVHRERFVDTWIKNNGAWQCVATTAAPMSAKQPTD |
Ga0187801_101691712 | 3300017933 | Freshwater Sediment | AMVGVFRVKGTEKGKPFVHRERFVDTWIKTNGAWQCVATTSALITAKQPAE |
Ga0187776_106278041 | 3300017966 | Tropical Peatland | AAVVVGIFRVKGTDKGKSYVHRERFVDTWIKINGTWQCVATTAALITAKAATD |
Ga0187816_101569122 | 3300017995 | Freshwater Sediment | IKGVEKGKAFVHRERFVDTWIKNNGAWQCVATTAAPMSAKQPTD |
Ga0187810_101664001 | 3300018012 | Freshwater Sediment | DKGKAYVHRERFVDTCIKINGTWQCVATTAALIAGKQAAD |
Ga0187810_104435712 | 3300018012 | Freshwater Sediment | VVHRERFVDTWIKNNGAWQCVATTAAPMSAKQPTD |
Ga0187766_111245342 | 3300018058 | Tropical Peatland | DKGKAYVHRERFVDTWIKTNGVWQCVATTSALITTKAE |
Ga0187774_110340042 | 3300018089 | Tropical Peatland | VVVGIFRVKGTEKGKPFLHRERFVDTWIKIDGAWKCVATTSALITAKPSGD |
Ga0193727_11307241 | 3300019886 | Soil | AVVVGVFRIKGTEKGKPYVRRERFVDTWIKLNGTWQCLATTSTLITGK |
Ga0193729_11237721 | 3300019887 | Soil | FRIKGIEKGKPYVHRERFTDTWIKHDQTWQCVASQATLIPSK |
Ga0193753_1000156120 | 3300020034 | Soil | TENNKPYVRRERFTDTWIKFNETWQCVASQTTLIPSK |
Ga0179592_101702972 | 3300020199 | Vadose Zone Soil | TEKGKPYVHRERFVDTWIKINGTWQCVATTGTLITAKPGAN |
Ga0179592_104615672 | 3300020199 | Vadose Zone Soil | AEKGKPYVHRERFVDTWIKLNGTWQCVATTGTLIAAKPGAN |
Ga0210407_101848671 | 3300020579 | Soil | GIFRIKGTEKGKPYVRRERFVDTWVKFDGMWQCVATTSALITAKQQPAD |
Ga0210407_107445911 | 3300020579 | Soil | VKGTEKGKPYVHRERFVDTWIKLNGTWQCVATTSTLITSKQGAD |
Ga0210406_104275732 | 3300021168 | Soil | RIKGMEKGKSYARRERFVDTWIKINGAWQCVATTSTLITAK |
Ga0210408_101368925 | 3300021178 | Soil | IKGMEKGKSYAHRERFVDTWIKISGAWQCVATTSTLITAK |
Ga0210408_101451774 | 3300021178 | Soil | GMEKGKAYVHRERFVDTWIKSNGTWQCVATTGTLITTKQQPAN |
Ga0210398_103009882 | 3300021477 | Soil | VKGMEKGKPYVHRERFVDTWIKTKGTWQCVATTGTLITTKQQPAD |
Ga0210409_100492256 | 3300021559 | Soil | VKGMEKGKPYVHRERFVDTWIKTKGTWQCVATTGTLITAKQQPAD |
Ga0210409_102097301 | 3300021559 | Soil | KGTEKGKPYVNRERFVDTWIKLKGTWQCVATTSTLITAK |
Ga0247695_10069753 | 3300024179 | Soil | KGTEKGKAYVHRERFIDTWIKQNQAWQCVASTATLITAK |
Ga0247680_10208201 | 3300024246 | Soil | VKGTEKGKAYVHRERFIDTWIKQNQAWQCVASTATLITAK |
Ga0207693_110464141 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KGKPYVRRERFADTWIKIHGTWQCVATTSTLIAAKQAAD |
Ga0209801_13251271 | 3300026326 | Soil | AVVVGIFRVKGMEKGKPYVHRERFIDTWIKQSQTWQCVASSATLISAK |
Ga0257154_10236591 | 3300026467 | Soil | MEKGKPYVHRERFVDTWIKTNGTWQCVATTSTLISGKQPSAD |
Ga0209806_12681531 | 3300026529 | Soil | VFRIKGTEKGKPYVHRERFLDTWIKVRGTWQCVATTSTLITAK |
Ga0207758_10074051 | 3300026895 | Tropical Forest Soil | PFVHRERFVDTWIKNNDAWQCVATTSTLITTKQAD |
Ga0207822_10253211 | 3300026981 | Tropical Forest Soil | VVGIFRVKGTDKGKPFVHRERFVDTWIKNNDAWQCVATTSTLITTKQAD |
Ga0209214_10148991 | 3300027071 | Forest Soil | KGKPYVHRERFTDTWIKHDQTWQCVASHSTLIPSK |
Ga0208990_11297341 | 3300027663 | Forest Soil | VVGIFRIKGTENGKPYVHRERFSDTWIKQNQTWQCVASQSTLITAK |
Ga0209274_101042541 | 3300027853 | Soil | KGTEKGKPYVHRERFVDTWIKLNGTWQCVATTSTLITAK |
Ga0209275_100512623 | 3300027884 | Soil | KGMEKGKPYVHRERFVDTWIKINGTWQCVATTGTLIAAKQQPAD |
Ga0307504_104243192 | 3300028792 | Soil | TENGKPYVRRERFTDTWIKLNETWQCVASQTTLIPGK |
Ga0302197_101405151 | 3300028873 | Bog | RGTDHGRPYVRRGRFIDTWIFEDQGWHCVASQATPILR |
Ga0311371_108502592 | 3300029951 | Palsa | YENAAVVVGVLRIKGTEKGKRYVHRERFVDTWIKLNTNWQCIATTSTLITAK |
Ga0310037_104155981 | 3300030494 | Peatlands Soil | AVVVGVFRVKGTEKGKAYLHRERFVDTWIKINGTWQCVATTSTLMTAK |
Ga0302309_103630331 | 3300030687 | Palsa | EKGKRYVHRERFVDTWIKLNTNWQCIATTSTLITAK |
Ga0170824_1005473632 | 3300031231 | Forest Soil | GKPYVRRERFVDTWIKTNGTWQCVATTSALITAKQPGD |
Ga0307474_105129212 | 3300031718 | Hardwood Forest Soil | VHRERFVDTWIKSKGTWECVATTGTLITAKPQPAD |
Ga0307475_103367451 | 3300031754 | Hardwood Forest Soil | KGKPYTHRERFVDTWIKMNGTWQCVVTTSTLITAK |
Ga0318567_108030911 | 3300031821 | Soil | PYVHRERFVDTWIKTNDSWQCVATTSTLLSGKPAD |
Ga0306919_101148314 | 3300031879 | Soil | VVGIFRVKGTEKGKPYVHRERFVDTWIKVNGTWQCVATTSTLITAKPSAH |
Ga0310912_108723971 | 3300031941 | Soil | GIFRIKGTDKGKPYVHRERFVDTWIKTNDSWQCVATTSTLLSGKPAD |
Ga0310912_109946392 | 3300031941 | Soil | FRVKGVEKGKSYVHRERFIDTWIKQNQGWQCVASSATLITTK |
Ga0310916_106463651 | 3300031942 | Soil | VKGVEKGKPYVHRERFIDTWIKHDQSWQCVASSATLITPK |
Ga0318506_105195861 | 3300032052 | Soil | TDKGKPFVHRERFVDTWIKSNRAWQCVATTSTLITAKQAD |
Ga0318510_102639911 | 3300032064 | Soil | DRGKPFVHRERFVDTWIKSNRAWQCVATTSTLITAKQAD |
Ga0306924_125272781 | 3300032076 | Soil | GKPFVHRERFVDTWIKSNRAWQCVATTSTLITAKQAD |
Ga0307470_101495353 | 3300032174 | Hardwood Forest Soil | IKGVEKGKPYVHRERFTDTWIKNGQSWQCVASQATLITAK |
Ga0307471_1036091501 | 3300032180 | Hardwood Forest Soil | GVFRIKGTEKGKPYVHRERFVDTWIKLHGTWQCVATTSTLITAK |
Ga0335082_109538752 | 3300032782 | Soil | RIKGTDKGKAYVRRERFVDTWIKTNGAWQCVATTSALITSKAD |
Ga0335080_111975301 | 3300032828 | Soil | AVVVGIFRVKGTEKGRPFVHRERFVDTWIKVNESWQCVATTSALITAKPSAD |
Ga0335070_120752961 | 3300032829 | Soil | FRVKGMDKGKPYMHRERFVDTWIKINGTWQCVATTAALITAKQPAD |
⦗Top⦘ |