NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101663

Metagenome / Metatranscriptome Family F101663

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101663
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 70 residues
Representative Sequence MIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Number of Associated Samples 96
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 68.63 %
% of genes near scaffold ends (potentially truncated) 47.06 %
% of genes from short scaffolds (< 2000 bps) 88.24 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.882 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.686 % of family members)
Environment Ontology (ENVO) Unclassified
(37.255 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.078 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 48.96%    β-sheet: 0.00%    Coil/Unstructured: 51.04%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF02627CMD 23.53
PF03401TctC 9.80
PF11306DUF3108 7.84
PF13714PEP_mutase 5.88
PF03480DctP 1.96
PF03435Sacchrp_dh_NADP 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 23.53
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 23.53
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 9.80


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.27 %
UnclassifiedrootN/A13.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004156|Ga0062589_102401283Not Available544Open in IMG/M
3300004479|Ga0062595_100419391All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus968Open in IMG/M
3300004643|Ga0062591_101846905All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus618Open in IMG/M
3300005093|Ga0062594_101258287All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria739Open in IMG/M
3300005293|Ga0065715_10450942All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13826Open in IMG/M
3300005328|Ga0070676_10119612All Organisms → cellular organisms → Bacteria → Proteobacteria1651Open in IMG/M
3300005331|Ga0070670_100331120All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1335Open in IMG/M
3300005331|Ga0070670_100967002All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus773Open in IMG/M
3300005345|Ga0070692_10207700All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1151Open in IMG/M
3300005347|Ga0070668_100964360All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13765Open in IMG/M
3300005353|Ga0070669_100427955All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1087Open in IMG/M
3300005438|Ga0070701_10086588All Organisms → cellular organisms → Bacteria1708Open in IMG/M
3300005441|Ga0070700_100054386All Organisms → cellular organisms → Bacteria2501Open in IMG/M
3300005456|Ga0070678_100997465All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria770Open in IMG/M
3300005543|Ga0070672_100198457All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300005617|Ga0068859_101239872All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus821Open in IMG/M
3300005618|Ga0068864_102615809Not Available510Open in IMG/M
3300005719|Ga0068861_100534414All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300005840|Ga0068870_10028156All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2818Open in IMG/M
3300005841|Ga0068863_102490921Not Available527Open in IMG/M
3300005844|Ga0068862_101541534All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus670Open in IMG/M
3300006057|Ga0075026_100891774Not Available546Open in IMG/M
3300006174|Ga0075014_100982309Not Available510Open in IMG/M
3300009094|Ga0111539_10372484All Organisms → cellular organisms → Bacteria → Proteobacteria1662Open in IMG/M
3300009098|Ga0105245_12573768All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus562Open in IMG/M
3300009159|Ga0114978_10189676All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1304Open in IMG/M
3300009183|Ga0114974_10770154Not Available518Open in IMG/M
3300009553|Ga0105249_10693629All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus1078Open in IMG/M
3300009661|Ga0105858_1040736All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus1184Open in IMG/M
3300010036|Ga0126305_10610658All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus734Open in IMG/M
3300010397|Ga0134124_10883038All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13899Open in IMG/M
3300010397|Ga0134124_12981470All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus517Open in IMG/M
3300010399|Ga0134127_13294262Not Available528Open in IMG/M
3300010401|Ga0134121_11906035All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus624Open in IMG/M
3300012006|Ga0119955_1002501All Organisms → cellular organisms → Bacteria → Proteobacteria8778Open in IMG/M
3300012893|Ga0157284_10125628All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13701Open in IMG/M
3300012901|Ga0157288_10047352All Organisms → cellular organisms → Bacteria → Proteobacteria984Open in IMG/M
3300012904|Ga0157282_10061516All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus951Open in IMG/M
3300012907|Ga0157283_10079450All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus831Open in IMG/M
3300012910|Ga0157308_10477563All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus502Open in IMG/M
3300013306|Ga0163162_12695687All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus572Open in IMG/M
3300013308|Ga0157375_10589465All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1271Open in IMG/M
3300014322|Ga0075355_1244989All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus515Open in IMG/M
3300014323|Ga0075356_1057594All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus857Open in IMG/M
3300014325|Ga0163163_10724366All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1058Open in IMG/M
3300014326|Ga0157380_10593922All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1094Open in IMG/M
3300014969|Ga0157376_10239038All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1691Open in IMG/M
3300015201|Ga0173478_10267769Not Available756Open in IMG/M
3300015372|Ga0132256_103425210All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus533Open in IMG/M
3300017965|Ga0190266_10006215All Organisms → cellular organisms → Bacteria → Proteobacteria2764Open in IMG/M
3300018067|Ga0184611_1068730All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1202Open in IMG/M
3300018072|Ga0184635_10056307All Organisms → cellular organisms → Bacteria → Proteobacteria1523Open in IMG/M
3300018081|Ga0184625_10123454All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1347Open in IMG/M
3300018083|Ga0184628_10184394All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1090Open in IMG/M
3300018083|Ga0184628_10289254All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria861Open in IMG/M
3300018476|Ga0190274_10628332All Organisms → cellular organisms → Bacteria → Proteobacteria1106Open in IMG/M
3300018476|Ga0190274_11296569All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria815Open in IMG/M
3300018476|Ga0190274_12891980All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus576Open in IMG/M
3300019263|Ga0184647_1354596All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus614Open in IMG/M
3300019361|Ga0173482_10585882All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria558Open in IMG/M
3300019362|Ga0173479_10011618All Organisms → cellular organisms → Bacteria → Proteobacteria2297Open in IMG/M
3300020034|Ga0193753_10197277All Organisms → cellular organisms → Bacteria → Proteobacteria926Open in IMG/M
3300022886|Ga0247746_1138162Not Available615Open in IMG/M
3300023069|Ga0247751_1033678All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus833Open in IMG/M
3300023184|Ga0214919_10020561All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales7402Open in IMG/M
3300025315|Ga0207697_10230112All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus818Open in IMG/M
3300025893|Ga0207682_10014299All Organisms → cellular organisms → Bacteria → Proteobacteria3091Open in IMG/M
3300025893|Ga0207682_10021243All Organisms → cellular organisms → Bacteria → Proteobacteria2553Open in IMG/M
3300025908|Ga0207643_10279061All Organisms → cellular organisms → Bacteria → Proteobacteria1036Open in IMG/M
3300025918|Ga0207662_10427757All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus902Open in IMG/M
3300025923|Ga0207681_10433710All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_131066Open in IMG/M
3300025925|Ga0207650_10711913All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus848Open in IMG/M
3300025932|Ga0207690_11363158All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13593Open in IMG/M
3300025944|Ga0207661_12159495Not Available503Open in IMG/M
3300025945|Ga0207679_10381251All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1236Open in IMG/M
3300025961|Ga0207712_10901759All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13781Open in IMG/M
3300026075|Ga0207708_10021226All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae4897Open in IMG/M
3300026095|Ga0207676_10043822All Organisms → cellular organisms → Bacteria → Proteobacteria3447Open in IMG/M
3300026118|Ga0207675_100194800All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus1945Open in IMG/M
3300026121|Ga0207683_10954177All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus796Open in IMG/M
3300026285|Ga0209438_1101170All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria871Open in IMG/M
3300026320|Ga0209131_1265005All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria667Open in IMG/M
3300027736|Ga0209190_1311407All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium597Open in IMG/M
3300028380|Ga0268265_11239972All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus744Open in IMG/M
3300028577|Ga0265318_10003262All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales8262Open in IMG/M
3300029984|Ga0311332_10766475All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus768Open in IMG/M
3300030294|Ga0311349_11538060Not Available617Open in IMG/M
3300031226|Ga0307497_10691223All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus525Open in IMG/M
3300031538|Ga0310888_10058348All Organisms → cellular organisms → Bacteria → Proteobacteria1835Open in IMG/M
3300031562|Ga0310886_10285297All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria938Open in IMG/M
3300031716|Ga0310813_10898632All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus803Open in IMG/M
3300031847|Ga0310907_10241285All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus885Open in IMG/M
3300031902|Ga0302322_103195336Not Available563Open in IMG/M
3300031938|Ga0308175_102788647Not Available546Open in IMG/M
3300031939|Ga0308174_10274505All Organisms → cellular organisms → Bacteria → Proteobacteria1319Open in IMG/M
3300032000|Ga0310903_10527730All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria620Open in IMG/M
3300032163|Ga0315281_10561193All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1206Open in IMG/M
3300032211|Ga0310896_10088792All Organisms → cellular organisms → Bacteria → Proteobacteria1357Open in IMG/M
3300033475|Ga0310811_11003735Not Available730Open in IMG/M
3300034149|Ga0364929_0163701All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_13725Open in IMG/M
3300034150|Ga0364933_029757All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_131330Open in IMG/M
3300034268|Ga0372943_0068293All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2027Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.88%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.90%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.94%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.96%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.96%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.96%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.98%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.98%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.98%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.98%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.98%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.98%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.98%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012006Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101BEnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300014323Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062589_10240128313300004156SoilMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0062595_10041939123300004479SoilMIEILTVLSLFIALAWAIVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0062591_10184690513300004643SoilLTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0062594_10125828723300005093SoilMIEILTVLSLFIALAWAIVRAVLMFVRTEAPADAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0065715_1045094213300005293Miscanthus RhizosphereMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0070676_1011961213300005328Miscanthus RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRTEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0070670_10033112013300005331Switchgrass RhizosphereMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR*
Ga0070670_10096700223300005331Switchgrass RhizosphereMIEILTVLSLFIALAWALVRAVLMFVRTDAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0070692_1020770023300005345Corn, Switchgrass And Miscanthus RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRANAADDARAPHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0070668_10096436023300005347Switchgrass RhizosphereMIEILTVLSLFIALGWAIVRAVLMFVRADTADDARSAHVDPISTYVDENYGSHFVDDPISINKSMRRR*
Ga0070669_10042795523300005353Switchgrass RhizosphereMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPITTYVDENYGSHFVDDP
Ga0070701_1008658833300005438Corn, Switchgrass And Miscanthus RhizosphereMIEILTVLSLFIALAWVLVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR*
Ga0070700_10005438613300005441Corn, Switchgrass And Miscanthus RhizosphereSWREVDLPLEAHMIEILTVLSLFIALAWAIVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR*
Ga0070678_10099746523300005456Miscanthus RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVD
Ga0070672_10019845713300005543Miscanthus RhizospherePQSIVTSWREVDLPLEAHMIEILTVLSLFIALAWAIVRAVLMFVRTEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0068859_10123987213300005617Switchgrass RhizosphereIVTSWREVDLPLEALMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR*
Ga0068864_10261580923300005618Switchgrass RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRTEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRR
Ga0068861_10053441413300005719Switchgrass RhizosphereEAHMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR*
Ga0068870_1002815623300005840Miscanthus RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRADTADDARSAHVDPISTYVDENYGSHFVDDPISINKSMRRR*
Ga0068863_10249092123300005841Switchgrass RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRTDAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0068862_10154153423300005844Switchgrass RhizosphereIVTSWREVDLPLEALMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0075026_10089177423300006057WatershedsMTEIFIVLGLFVGLAWAIVRAVLMFVRSDATDDVPVAHIDPISTYVDENYGSHFVDDPVSVNQSLRKF*
Ga0075014_10098230923300006174WatershedsMAEIFIVLSLFVALAWAIVRSVLMFVRSDARADIPAAHADPISTYVEENYGSHFVDDPVSVNRSLRRR*
Ga0111539_1037248433300009094Populus RhizosphereMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR*
Ga0105245_1257376813300009098Miscanthus RhizosphereLAWALVRAVLMFVRTEAPGDAPAAHIDPITTYVDENYGSHFVDDPVSVNQSMRKR*
Ga0114978_1018967623300009159Freshwater LakeMTEVLIVLSLFVALAWAIVRAVLMFVRIDAADEVPSQHADPISTYVDENYGSHFVDDPISINHSMRRR*
Ga0114974_1077015413300009183Freshwater LakeMTEVLIVLSLFVALAWAIVRAVLMFVRIEAVDEVPSQHADPISTYVDENYGSHFVDDPISINHSMRSR*
Ga0105249_1069362923300009553Switchgrass RhizosphereMIEILTVLSLFIALAWALVRAVLMFVRTEAPGDAPAAHIDPITTYVDENYGSHFVDDPISVNQSMRRR*
Ga0105858_104073623300009661Permafrost SoilMTEIFIVLGLFVACAWAIVRAVLMLARADAPADIPTAHADPISTYVEENYGSHFVDDPFSVNHHPRRR*
Ga0126305_1061065823300010036Serpentine SoilMVEILIVLSLFVALVWAIVHAVLIFVRADARAESAASQADPISTYVDENYGSHFVDDPVSVNHSLRRK*
Ga0134124_1088303823300010397Terrestrial SoilMIEILTVLSLFIALAWAIVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR*
Ga0134124_1298147013300010397Terrestrial SoilIVLGLFVGLVWAIAHAVLIFVRPVTQEEMPAAHSDPISTYIEENYGSHFVDDPVSINQSMRRL*
Ga0134127_1329426213300010399Terrestrial SoilMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSM
Ga0134121_1190603523300010401Terrestrial SoilGAPADYVCLLASSSQQRQEAAMIEIFIVLGLFVALAWAIVHAVLIFVRPVTQEEMPAAHSDPISTYIEENYGSHFVDDPVSINQSMRKR*
Ga0119955_100250123300012006FreshwaterVASLARRSLLPLEASTTEVLIVLSLFVALAWAIVRAVLMFVRIDAADEVPSQHADPISTYVDENYGSHFVDDPISINHSMRRR*
Ga0157284_1012562823300012893SoilMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR*
Ga0157288_1004735213300012901SoilREVDLPLEALMIEILTVLSLFIALAWALVRAVLMFVRTEAPGDAPAAHIDPITTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0157282_1006151623300012904SoilMIEILTVLSLFIALGWAIVRAVLMFVRADTADDARAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR*
Ga0157283_1007945013300012907SoilILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0157308_1047756323300012910SoilALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0163162_1269568723300013306Switchgrass RhizosphereCWPAVPPQSIVTSWREVDLPLEAHMIEILTVLSLFIALAWALVRAVLMFVRTEAPADAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR*
Ga0157375_1058946533300013308Miscanthus RhizosphereMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQS
Ga0075355_124498923300014322Natural And Restored WetlandsMVTSWREIRELPQEAAMIEIFIVIGLFVALAWAIVHAVLIFVRAVAPGELPAAHIDPISTYVDENYGSHFVDDPISVNHSLRRR*
Ga0075356_105759423300014323Natural And Restored WetlandsMVTSWREIRELPQEAAMIEIFIVIGLFVALAWAIVHAVWIFVRADAPGELPAAHIDPISTYVDENYGSHFVDDPISVNHSLRRR*
Ga0163163_1072436623300014325Switchgrass RhizosphereMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVD
Ga0157380_1059392223300014326Switchgrass RhizosphereMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMR
Ga0157376_1023903813300014969Miscanthus RhizosphereMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMLRR*
Ga0173478_1026776923300015201SoilMIEILTVLSLFIALAWALVRAVLMFVRTEAPGDAPAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR*
Ga0132256_10342521013300015372Arabidopsis RhizosphereLAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR*
Ga0190266_1000621543300017965SoilMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR
Ga0184611_106873023300018067Groundwater SedimentMIEILTVLSLFIALAWALVRAVLMFVRTEAPGDAPAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR
Ga0184635_1005630733300018072Groundwater SedimentMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR
Ga0184625_1012345423300018081Groundwater SedimentMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0184628_1018439423300018083Groundwater SedimentMIEILTVLSLFIALGWAIVRAVLMFVRADTADDARAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR
Ga0184628_1028925423300018083Groundwater SedimentMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPISVNQS
Ga0190274_1062833213300018476SoilRPSDCWPTVPLRIIVTSRREVDLPLEVLMIEILIVLSLFIALAWALVRAVLMFVRADAADDARAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR
Ga0190274_1129656913300018476SoilMIEILTVLSLFIALAWALVRAVLMFVRTDAPGDAPAAHIDPITTYVDENYGSHFVDDPISVNQSRRRR
Ga0190274_1289198023300018476SoilEALMIEILTVLSLFIALAWALVRAVLMFVRADTADDARTAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR
Ga0184647_135459613300019263Groundwater SedimentVPSRPIVISRREVDLPLEAHMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0173482_1058588213300019361SoilMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVD
Ga0173479_1001161843300019362SoilMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0193753_1019727733300020034SoilLFVALAWAIVHAVLMFVRPAIQDEMPAAHSDPISTYIEENYGSHFVDDPVSVNQSMRRR
Ga0247746_113816223300022886SoilMIEILTVLSLFIALAWALVRAVLMFVRTEAPGDAPAAHIDPITTYVDENYGSHFVDDPISVNQSMRRR
Ga0247751_103367813300023069SoilLEAHMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPITTYVDENYGSHFVDDPISVNQSMRRR
Ga0214919_1002056163300023184FreshwaterMTEVLIVLSLFVALAWAIVRAVLMFVRIDAADEVPSQHADPISTYVDENYGSHFVDDPISINHSMRRR
Ga0207697_1023011223300025315Corn, Switchgrass And Miscanthus RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0207682_1001429953300025893Miscanthus RhizosphereMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR
Ga0207682_1002124343300025893Miscanthus RhizosphereVASWREVDLPLEALMIEILTVLSLFIALAWAIVRAVLMFVRADTADDARSAHVDPISTYVDENYGSHFVDDPISINKSMRRR
Ga0207643_1027906113300025908Miscanthus RhizosphereLTVLSLFIALAWAIVRAVLMFVRADTADDARSAHVDPISTYVDENYGSHFVDDPISINKSMRRR
Ga0207662_1042775723300025918Switchgrass RhizosphereMIEILTVLSLFIALAWALVRAVLMFVRTDAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0207681_1043371023300025923Switchgrass RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRTEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0207650_1071191313300025925Switchgrass RhizosphereAVPSRIIVTSWREVDLPLEALMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR
Ga0207690_1136315823300025932Corn RhizosphereMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVS
Ga0207661_1215949513300025944Corn RhizosphereMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPISVNQSM
Ga0207679_1038125113300025945Corn RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRTEAPADAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0207712_1090175923300025961Switchgrass RhizosphereMIEILTVLSLFIALAWAIVRAVLMFVRTDAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0207708_1002122613300026075Corn, Switchgrass And Miscanthus RhizosphereSRIIVTSWREVDLPLEALMIEILTVLSLFIALAWAIVRAVLMFVRADTADDARSAHVDPISTYVDENYGSHFVDDPISINKSMRRR
Ga0207676_1004382253300026095Switchgrass RhizosphereMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRR
Ga0207675_10019480033300026118Switchgrass RhizosphereMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR
Ga0207683_1095417713300026121Miscanthus RhizosphereLTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0209438_110117023300026285Grasslands SoilMIEIFIVLGLFVALVWAIVHAVLILVRPAMPEEVPTAHIDPISTYIEENYGSHFVDDPISINQSMRRL
Ga0209131_126500523300026320Grasslands SoilMIEIFIVLSLFVALAWAIVHAVLMFVRPAMQEEMPAAHSDPISTYIEENYGSHFVDDPISINQSMRRH
Ga0209190_131140713300027736Freshwater LakeRRATVASLARRSLLPLEASMTEVLIVLSLFVALAWAIVRAVLMFVRIDAADEVPSQHADPISTYVDENYGSHFVDDPISINHSMRRR
Ga0268265_1123997213300028380Switchgrass RhizosphereIEILTVLSLFIALAWAIVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0265318_1000326273300028577RhizosphereMIEVFIVVGLFVALAWAIVHAVLIFVRVDAPDELPAAHIDPISTYVDENYGSHFVDDPVSVNHSLHRR
Ga0311332_1076647523300029984FenPAAYGGFLTGTLHQPQEAAMSEIFIVLGLFVALAWAIAHAVLIVVRVGAPHDVSASHIDPISTYIEENYGSHFVDDPISINHGLRRR
Ga0311349_1153806013300030294FenMSEFFIVLGLFVALAWTIIRTVLMFLRVDVQEDAPTAHADPISTYVDENYGSHFVDDPVTANRDLRRL
Ga0307497_1069122323300031226SoilRTIVTSWREVDLPLEALMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0310888_1005834823300031538SoilMIEILTVLSLFIALAWALVRAVLMFVRTDAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR
Ga0310886_1028529713300031562SoilMIEILTVLSLFIALAWALVRAVLLFVRAEAPGDAPAAHIDPITTYVDENYGSHFVDDPISVNQSMRRR
Ga0310813_1089863213300031716SoilILTVLSLFIALAWAIVRAVLMFVRTEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0310907_1024128523300031847SoilMIEILTVLSLFIALAWAIVRAVLMFVRADAADDARAPHIDPISTYVDENYGSHFVDDPVSVNQSMRRR
Ga0302322_10319533613300031902FenMSEFLIVLGLFVALAWTIIRTVLMFLRVDVQEDAPTAHADPISTYVDENYGSHFVDDPVTANRDLRRL
Ga0308175_10278864713300031938SoilMSEIFIMSGLFIALAWTIAHAVLIVVRAGAPRDVPGSHIDPISTYVEENYGSHFVDDPISINHSLRRR
Ga0308174_1027450533300031939SoilMSEIFIVLGLFVALAWAITHAMLILVRVGVPHDAPASPIDPISTYVEENYGSHFVDDPVSINHSLRRR
Ga0310903_1052773023300032000SoilMIEILTVLSLFIALAWAIVRAVLMFVRTEAPGDAPAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR
Ga0315281_1056119323300032163SedimentMMTEILIVLSLFAALVWAIVRAVLMLVRIDVPDDVPAQHGDPISTYVDENYGSHFVDDPISINQSLRRR
Ga0310896_1008879213300032211SoilAHMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQSMRKR
Ga0310811_1100373513300033475SoilMIEILTVLSLFIALAWAIVRAVLMFVRTEAPGDAPAAHIDPISTYIDENYGSHFVDDPIS
Ga0364929_0163701_536_7243300034149SedimentMIEILTVLSLFIALAWALVRAVLMFVRAEAPGDAPAAHIDPISTYVDENYGSHFVDDPVSVNQ
Ga0364933_029757_429_6353300034150SedimentMIEILTVLSLFIALVWALVRAVLMFVRAEAPGDTPAAHIDPISTYVDENYGSHFVDDPISVNQSMRRR
Ga0372943_0068293_769_9723300034268SoilVELIISAGLFVALAWVIAHAALIFLRGDAAQESAAAPVDRISTYVDENYGSHFVDDPVSVNRSMRRL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.